KEGG   Streptococcus agalactiae GD201008-001 (serotype Ia): A964_0496Help
Entry
A964_0496         CDS       T02248                                 

Gene name
atoB
Definition
(GenBank) thiolase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sgc  Streptococcus agalactiae GD201008-001 (serotype Ia)
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:sgc00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    A964_0496 (atoB)
   00630 Glyoxylate and dicarboxylate metabolism
    A964_0496 (atoB)
   00640 Propanoate metabolism
    A964_0496 (atoB)
   00650 Butanoate metabolism
    A964_0496 (atoB)
  Lipid metabolism
   00071 Fatty acid degradation
    A964_0496 (atoB)
   00072 Synthesis and degradation of ketone bodies
    A964_0496 (atoB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    A964_0496 (atoB)
   00310 Lysine degradation
    A964_0496 (atoB)
   00380 Tryptophan metabolism
    A964_0496 (atoB)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    A964_0496 (atoB)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    A964_0496 (atoB)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    A964_0496 (atoB)
Enzymes [BR:sgc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     A964_0496 (atoB)
Exosome [BR:sgc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   A964_0496 (atoB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
510640..511755
Genome map
AA seq 371 aa AA seqDB search
MKNRDVYIGFGLRTPIGIKGKQFKHYRPELLGAHLLNQIKKIESESNIDSIICGNTVGTG
GNIGRLMTLFSDYESYIPVQTIDMQCASSSSALFFGYLKISTGINEKVLVGGIESSSLQP
MRRYAKEDNRNGEYTVAQFSPDSYAETVMLEGAQRVCQKYGFRREMLDKLAFLSHKRALT
AKQGGYLEEVILPMEGMRDQGVRKLKETFFQKLPRLMENSPLLTIGNVCLMHDAAAFLTL
QSQKTEFRIVHIVEVAGDPKLSPELVHTATEKLLTETHTKISDYDAIEWNEPFAAIDALF
NHYYPEEREKFNIFGGTLAYGHPYACSGIINILHLMQALKYKNKPMGLTAIAGAGGVGMA
ISIEYLGVKNA
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgaagaatagagatgtttatattggttttgggctacgaacacctatcggtataaaaggg
aagcaatttaaacattaccgtccagaacttttaggagcacaccttttaaatcaaataaaa
aaaatagaatcagaatctaacattgatagtattatttgtgggaacacagttggtactggg
ggcaatattggtcgtttgatgactcttttttctgattatgaatcctatattccagtacaa
acgattgatatgcagtgtgcttcatcaagttctgccttgttttttggttatctaaaaatc
agtaccggtattaatgaaaaagttcttgttggggggattgaaagtagttctcttcaacct
atgagacgttatgctaaagaagataatcgtaacggagaatatacagttgctcagttttct
cctgactcttatgctgaaactgtaatgttagaaggggcccagagagtctgtcaaaaatat
ggttttagaagagaaatgttagataaattggcattcttgagccataaacgcgccttaaca
gctaaacaaggtggctatttagaagaggtaatcttaccaatggaagggatgcgagatcaa
ggcgttagaaaactaaaagaaacattttttcaaaaattaccaagattgatggaaaattca
cctttgctcactattggaaatgtttgtttaatgcacgatgctgctgcatttctaacgctt
cagagtcagaaaacagaattccggattgttcacattgtagaagtagcaggagatcccaag
cttagtccagaattggttcacacggctacggaaaaactattaacagaaactcatactaaa
atatcggattatgatgcaattgaatggaatgaaccatttgcagcgattgatgctctattt
aatcattattatcctgaagagagagaaaaattcaatatttttggagggacattagcttac
ggacacccttatgcctgctcaggaattattaatatccttcatcttatgcaggcattaaaa
tataaaaataaacctatgggtctaactgccattgcaggggcaggaggagtcggaatggcc
atatcaatagagtacttaggagttaagaatgcttga

DBGET integrated database retrieval system