KEGG   Streptococcus agalactiae GD201008-001 (serotype Ia): A964_0548Help
Entry
A964_0548         CDS       T02248                                 

Gene name
fbp3
Definition
fructose-1,6-bisphosphatase
Orthology
K04041  
fructose-1,6-bisphosphatase III [EC:3.1.3.11]
Organism
sgc  Streptococcus agalactiae GD201008-001 (serotype Ia)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sgc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    A964_0548 (fbp3)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    A964_0548 (fbp3)
   00030 Pentose phosphate pathway
    A964_0548 (fbp3)
   00051 Fructose and mannose metabolism
    A964_0548 (fbp3)
  Energy metabolism
   00680 Methane metabolism
    A964_0548 (fbp3)
Enzymes [BR:sgc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     A964_0548 (fbp3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
564268..566199
Genome map
AA seq 643 aa AA seqDB search
MSNFYKLLKEKFPRKEDIVTEMINLEAICQLPKGTEYFISDLHGEYDAVDYLLRTGAGSI
RAKLLDCFDWQKIVAVDLDDFCILLYYPKEKLAFDKMNLSASAYKTKLWEMIPLQIQVLK
YFSSKYTKSKVRKQLSGKFAYIIEELLAEIDRNPEKKSYFDTIIEKLFELDQVEDLIIVL
SQTIQVLIIDHLHVVGDIYDRGRYPDRILNRLMAFPNLDIQWGNHDVTWMGAASGSYLCM
VNVIRIAARYNNITLIEDRYGINLRRLVDYSRRYYEPLPSFVPILDGEEMTHPDELDLLN
MIQQATAILQFKLEAQLIDRRPEFQMHNRQLINQVNYKDLSISIKEVVHQLKDFNSRCID
SKNPSRLTSEEEELLQQLMIAFQTSESLKKHIDFLFEKGSMYLTYNDNLLFHGCIPMHSN
GDFKSFKIAGKTYGGRDLLDLFESQIRLAYARPEKHDDLATDIIWYLWCGENSSLFGKNA
MTTFERYYVSDKVTHQERKNPYFKLRDKDDICNALLQEFDLPKFGHIVNGHTPVKEKNGE
QPIKANGKMLVIDGGFAKGYQKNTGLAGYTLIYNSYGIQLISHLPFTSIEEVLSGTNYII
DTKRLVEEAKDRILVKDTTIGQKLTKEIKDLDHLYRHFQEYDD
NT seq 1932 nt NT seq  +upstreamnt  +downstreamnt
atgtctaatttttataagctcttgaaagaaaaatttcctcgaaaagaagatatcgtaaca
gaaatgatcaatttagaagctatttgtcaattacccaaagggacggagtattttattagt
gatttacacggggaatacgatgctgttgattatctcttacggacaggtgcagggtctatt
agagctaaattattagactgttttgattggcagaaaatagttgctgttgatttagatgat
ttttgtatactgctttattacccaaaggaaaaattagccttcgataaaatgaacttgtca
gcaagtgcttataaaacgaagttatgggaaatgattccgttacaaatacaagttttaaaa
tatttttctagtaaatatacaaaatctaaagtacgtaagcaattgtcaggtaagtttgct
tacattatcgaagaacttttagctgagattgaccgtaacccagagaagaaaagctatttt
gatactattattgaaaaattatttgaattagaccaagtagaagatttaattatagtattg
tcccaaacaattcaagttttgattattgaccatttacatgttgtaggggatatttacgat
cgtggtaggtatcctgatcgtatcttgaataggttaatggcttttccaaatttggatatc
caatgggggaaccatgatgtcacttggatgggagcagcatctggttcttacctttgtatg
gtaaatgttatccgtattgctgcacgttataataatattactttaattgaagaccgatat
ggtatcaatttgcgtcgcttggttgattactcacgccgttactatgaacctctaccttct
ttcgttcctatattagatggagaggaaatgactcatccagatgaactagacttgttaaat
atgatacaacaagcaacagcaattttacagtttaaattggaagcccaattgattgacagg
cgtccagaatttcaaatgcataatcggcaacttattaaccaggtaaattataaagattta
agtatatctattaaggaagttgtgcatcaacttaaagattttaatagtagatgcattgat
tcgaaaaatcccagtcgattaacaagtgaggaagaagagcttttacaacaattgatgata
gccttccagacttctgaaagtttaaagaaacatattgatttcctatttgaaaaaggaagt
atgtatttaacatataatgataatcttttattccatggttgcataccaatgcatagtaat
ggtgattttaaaagctttaaaattgcaggaaaaacttatggtggtagggatttactggat
ttatttgaaagtcaaatacgtctagcatatgctagaccagagaaacatgatgatttggcg
acagatatcatttggtatctttggtgtggtgaaaattcttctctttttggtaagaatgcc
atgactacttttgagcgctattatgtttccgacaaagtaactcatcaagaaagaaaaaat
ccctactttaaactgagagataaagatgatatttgcaatgctcttttacaagagtttgat
ttgcctaagtttgggcatattgtcaatggtcatacgccagtcaaagaaaaaaatggtgag
caaccgataaaagcaaatggtaagatgttagtaattgatggtggctttgccaaaggttat
cagaaaaatacaggtttagctggctacactttgatttataatagctatgggatacaatta
atttcacaccttccttttacatccattgaggaagttttaagtggaaccaactatatcatt
gatacgaagcgattagtagaagaagccaaggataggattcttgtaaaagatacaactatt
ggacaaaagttaaccaaagagattaaagacttagatcacctttatcgtcattttcaggaa
tatgatgactag

DBGET integrated database retrieval system