KEGG   Streptococcus agalactiae GD201008-001 (serotype Ia): A964_0704Help
Entry
A964_0704         CDS       T02248                                 

Gene name
nagZ
Definition
glycosyl hydrolase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
sgc  Streptococcus agalactiae GD201008-001 (serotype Ia)
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:sgc00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    A964_0704 (nagZ)
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    A964_0704 (nagZ)
Enzymes [BR:sgc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     A964_0704 (nagZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
724484..726274
Genome map
AA seq 596 aa AA seqDB search
MTHLVDLTKKPFNLNQEAIEWIEKTINEMTLDEKIGQLFFNMGASRSEEYLTDVLDRYHI
AAVRYNRGSSSEIYDQNLILQTKSKLPMLIAANTEAGGDGAVTDGTKVGDEIKVAATNDP
KYAYEMGRIAGMEASAVGCNASFAPIVDLTRNWRNPIIASRNWGANVDQIISLSKEYMKG
IMQYNIVPFAKHFPGDGIDERDHHLSFASNPMSKEEWMSTFGRIYGELADAGLPGVMAGH
IHLPNVEKEMHPERDLDDMLPASLNKTLLDELLRGELGYNGAIVTDASHMVGMTASMPRR
DLLPTAIEAGCDLFLFFNDPDEDIQWMKEGYEKGILTEERLHDALRRTLGLKAKLGLHNY
EGRRQELFMPKYKAMALINTLESQKIADEVADKAVTLVKDKQKDIFPVNPERYRHILLVN
VEGYKGGFGAMIAGNKQRASDYMKELLEERGHEVTVWESTEERIMKLPQEERAAAIANVY
AQKQPIENLTEHYDLIINLVDVNAGGTTQRIIWPAAKGTPDQPFYVHEIPSIVISVQHAF
ALADMPQVGTYINAYDGLPSTISAVVAKLAGESEFTGVSPVDAYCGLIDTHLWRQC
NT seq 1791 nt NT seq  +upstreamnt  +downstreamnt
atgacacatttagttgacttaacaaaaaaaccctttaacctaaatcaagaagcaattgag
tggattgaaaaaacaattaatgagatgacattggatgagaaaattgggcaactttttttc
aatatgggagctagtcgttcagaagaatatttaacagatgttttggatcggtatcatatt
gctgctgttcgctataatagaggtagttcaagtgaaatctatgatcagaatttaatttta
cagacaaagtcgaaattgccgatgttgattgctgcaaatacagaagctggtggagacggt
gctgtcacagatggaactaaagttggcgatgaaataaaagtggctgctacaaatgatccg
aaatatgcttatgaaatgggaagaatcgcagggatggaggcatctgctgtgggttgtaat
gcttcatttgctccaattgtagatttgacacgtaattggcgtaatcctatcatagctagt
cgaaattggggtgctaacgttgatcaaattatctcactttcaaaagagtatatgaaagga
atcatgcaatataatattgtacctttcgctaaacattttccaggggatggcattgatgag
cgtgatcatcatttgtcatttgcttccaatcctatgagtaaagaggaatggatgtcgaca
tttggccgcatttatggtgaattggctgacgcaggtctaccaggagtcatggcaggtcac
atacatttaccaaatgttgaaaaagaaatgcatccagagcgagaccttgatgatatgtta
ccagcttcattgaataaaacacttttagatgagttattgagaggagagttaggttataat
ggagctattgtaacggacgcttctcatatggttggaatgactgcttcaatgccaaggaga
gatttgttgccaacggcgattgaagcaggttgtgacttgttcttattctttaatgacccc
gatgaagacattcaatggatgaaagaaggttacgaaaaaggtattctaacagaggaacgt
ctccatgacgctttacgtcgtactctcggtctaaaagcgaaattaggcttgcataactat
gagggacgtcgccaagaactctttatgcctaaatataaggctatggctttaatcaacaca
ttagagtcgcaaaaaatagctgatgaagttgctgataaagcagtaactctggtaaaagat
aaacaaaaagatatctttccagtaaatccagaacgttatcgtcatatcttacttgttaac
gttgaaggatataagggaggttttggtgcgatgattgctggaaacaagcaacgtgcatcg
gattacatgaaagagttacttgaggaacgtggccatgaagtaactgtctgggagtctacc
gaagagcgtattatgaaattgcctcaagaggagcgggcagcagctatcgctaatgtttac
gcacaaaaacagccaatcgaaaatctaacagaacactatgacctgattattaacttggta
gatgtcaatgctggaggaacaacacaacgtattatttggccagcagctaaaggcacccct
gatcagcctttttacgttcatgaaataccatctattgtgatttcagtgcaacatgcattt
gctttagcagatatgccacaggtagggacttatattaatgcttacgatgggcttcctagc
acgataagtgcagtagttgcgaaattggctggagaatcagaatttacaggagtttcacca
gtagatgcttactgtggtttaattgatacacatttatggcgtcaatgctaa

DBGET integrated database retrieval system