KEGG   Streptococcus agalactiae GD201008-001 (serotype Ia): A964_0765Help
Entry
A964_0765         CDS       T02248                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
sgc  Streptococcus agalactiae GD201008-001 (serotype Ia)
Pathway
sgc00010  Glycolysis / Gluconeogenesis
sgc00051  Fructose and mannose metabolism
sgc00562  Inositol phosphate metabolism
sgc01100  Metabolic pathways
sgc01110  Biosynthesis of secondary metabolites
sgc01120  Microbial metabolism in diverse environments
sgc01130  Biosynthesis of antibiotics
sgc01200  Carbon metabolism
sgc01230  Biosynthesis of amino acids
Module
sgc_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
sgc_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:sgc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    A964_0765 (tpiA)
   00051 Fructose and mannose metabolism
    A964_0765 (tpiA)
   00562 Inositol phosphate metabolism
    A964_0765 (tpiA)
Enzymes [BR:sgc01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     A964_0765 (tpiA)
Exosome [BR:sgc04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   A964_0765 (tpiA)
  Exosomal proteins of bladder cancer cells
   A964_0765 (tpiA)
  Exosomal proteins of melanoma cells
   A964_0765 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: AFS45541
Position
790194..790952
Genome map
AA seq 252 aa AA seqDB search
MSRKPFIAGNWKMNKNPEEAKAFIEAVASKLPSSELVEAGIAAPALTLSTVLEAAKGSEL
KIAAQNSYFENSGAFTGENSPKVLAEMGTDYVVIGHSERRDYFHETDQDINKKAKAIFAN
GLTPIICCGESLETYEAGKAVEFVGAQVSAALAGLSEEQVSSLVIAYEPIWAIGTGKSAT
QDDAQNMCKAVRDVVAADFGQAVADKVRVQYGGSVKPENVAEYMACPDVDGALVGGASLE
AESFLALLDFVK
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgtaaaccatttatcgctggtaactggaaaatgaataaaaatccagaagaagca
aaagcattcatcgaagcagtagcttctaaattaccatcatcagaacttgttgaagcaggg
attgctgctccagcgcttactttatcaacagttcttgaagcagctaaaggttcagaattg
aaaatcgctgctcaaaatagctattttgagaattcaggtgcattcactggtgaaaacagc
cctaaagtattggctgaaatgggtacagactacgttgttatcggtcactcagaacgtcgt
gattatttccatgaaactgaccaagatatcaacaaaaaagcaaaagctatctttgctaat
ggtttgactccaatcatttgttgcggtgagtctcttgaaacttacgaagctggtaaagcg
gttgaattcgtaggtgctcaagtttcagcagctcttgcaggtttgtcagaagagcaagta
tcatcacttgttatcgcttacgaaccaatctgggctattggtactggtaaatcagcaact
caagacgacgcacaaaacatgtgtaaagcagttcgtgacgttgttgcagcagacttcggt
caagcagttgctgacaaagttcgcgttcaatacggtggttcagttaaacctgaaaacgtt
gcagaatatatggcttgcccagacgttgacggtgcccttgtaggtggagcttcacttgaa
gcagaaagcttccttgccttattagattttgttaaataa

DBGET integrated database retrieval system