KEGG   Streptococcus agalactiae GD201008-001 (serotype Ia): A964_0795Help
Entry
A964_0795         CDS       T02248                                 

Gene name
bglA
Definition
6-phospho-beta-glucosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
sgc  Streptococcus agalactiae GD201008-001 (serotype Ia)
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:sgc00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
821357..822784
Genome map
AA seq 475 aa AA seqDB search
MTVFPKHFLWGGAVAANQVEGAFRTDGKGLSVQDVLPNGGLGDFTAKPTPDNLKLEAIDF
YHNYKNDIKLFAEMGFKVFRTSIAWSRIFPNGDDSAPNEAGLQFYDNLFDELLKYNIEPL
VTLSHYETPLHLAKTYNGWADRRLIAFFEKFAQTVMERYKDKVKYWLTFNEVNSILHMPF
TSGAIMTDKSQLSPQELYQAIHHELVASARVTKLGRSINPNFKIGCMILAMPAYPMTSDP
RDVLAARQFEQHNLLFSDIHVRGKYPTYIQSYFKNNGIKIKFEEGDEEVLAQNTVDFLSF
SYYMSVTQAYDFENYQSGQGNILGGLTNPHLTTSEWGWQIDPIGLRLVLNQYYERYQIPL
FIVENGLGAKDQLIETLDGDYTVEDDYRIDYMNQHLVQVAKAIEDGVEIMGYTSWGCIDC
VSMSTAQLSKRYGLIYVDRNDDGTGSLQRYKKKSFGWYQKVIKTNGQSLFEHHNR
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgacggtttttcctaaacattttctatggggaggtgcagttgctgccaatcaggtagag
ggtgcatttagaacagatggcaaaggtttatctgtacaagatgtacttccaaatggtggt
ttaggcgatttcaccgccaaacctactccagacaatttgaagctagaagcaattgatttt
tatcataactataaaaatgatataaaactgtttgcagagatgggctttaaagtttttaga
acctctattgcctggtctcgaatttttccaaatggtgatgatagtgctccaaacgaagct
ggcttacaattttatgataatttatttgatgagttgcttaaatataatatcgagcccttg
gttaccttatctcattatgaaacaccgcttcatcttgcaaaaacttataatggttgggct
gatagacgtttgatagcattttttgagaaatttgctcaaacagtcatggagcgttataaa
gataaggtgaaatattggttgacttttaatgaagtgaattctattttacatatgcctttc
accagtggtgctattatgaccgacaaatcacaactaagtcctcaggagctttatcaagct
attcatcatgaattagtagcatcggctagagtgacaaaattagggcgttctatcaatcct
aattttaaaattggctgtatgattctggctatgccagcttatcctatgacatctgatcca
agagatgtcctggctgcaagacaatttgaacaacataatctgctattttcagatatacat
gtcagaggtaaatatcccacttatattcagtcctatttcaaaaataatggtattaaaatt
aaatttgaagaaggagatgaggaagtattggcacaaaatacagtagattttctatcgttt
agttactatatgagcgtgacacaagcttatgactttgaaaattatcaaagtggtcaggga
aatatccttggaggcctaactaatcctcatttaacaacttcagaatggggatggcaaatc
gatcccatcgggctacgcctagtcttaaatcagtattatgaacgttatcagattccgttg
tttattgtagaaaatggattgggagcaaaagatcaattgatagaaacactagacggtgat
tatactgtcgaagatgattatcgtattgattatatgaatcaacatttagttcaagttgct
aaagctattgaagatggtgttgaaataatgggatatacatcttgggggtgtattgattgt
gtatccatgtctacagctcaactaagtaaacgttatggtctaatatatgttgatcgaaat
gatgatggaacagggagtctacaacgttacaagaagaagtcatttggttggtaccaaaaa
gtgattaagacaaatggccaatcattgtttgaacatcataacagataa

DBGET integrated database retrieval system