KEGG   Streptococcus agalactiae GD201008-001 (serotype Ia): A964_0889Help
Entry
A964_0889         CDS       T02248                                 

Gene name
murE
Definition
mur ligase family protein
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
sgc  Streptococcus agalactiae GD201008-001 (serotype Ia)
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:sgc00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:sgc00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(925795..927138)
Genome map
AA seq 447 aa AA seqDB search
MKINTALGVAAGKSAHYLLSKMGRGSTYPGSLALKFDKDILDTIAKDYEIVVVTGTNGKT
LTTALTVGILKEAFGQVVTNPSGANMITGIVSTFLTAKKSKSGKKIAVLEIDEASLPRIT
QYIKPSLFVFTNIFRDQMDRYGEIYTTYQMILDGAANAPQATILANGDSPLFNSKSVTNP
VQFYGFNTDKHEPRLAHYNTEGILCPKCQAILTYRLNTYANLGDYTCPNCDFERPNLDYA
LTRLTHLTNTSSGFVIDGQQYNINVGGLYNIYNALAAVSVAEYFGVEPSQIKDGFDKSRA
VFGRQETFTIGNKKCTLVLIKNPVGASQALDMIKLAPYPFSLSVLLNANYADGIDTSWIW
DANFETILTMNIPEIFAGGVRHSEIARRLRVTGYDEKRIKQADKLQDIMTMIEQQETEHA
YILATYTAMLEFREILANHNAIRKEMN
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgaaaataaatacagcactaggagtggctgccggtaagtctgctcattaccttttaagt
aaaatgggacgtggctctacttatccgggtagtttagcactcaaattcgataaagatata
ctagatacaattgccaaagattatgaaattgtagttgtgactggtactaacggtaaaacc
ttaacaacagctttaacagttggtattttaaaggaagccttcggtcaggtggtaaccaac
ccaagtggagcaaatatgattacaggtattgtttcgaccttcctaacagctaagaaaagt
aaatctggtaaaaaaatagctgtccttgaaatagacgaagcgagtttaccccgtattaca
cagtatataaagcctagtttgttcgtctttaccaatattttccgtgatcaaatggaccgt
tatggcgaaatctacacaacttatcaaatgattttagatggagctgctaacgctccgcaa
gctactatcttagctaacggtgacagtccactttttaattctaaaagcgtgactaaccct
gtgcaattctatggatttaataccgacaaacatgagccacgattagcacactataatact
gagggtattctctgtccaaagtgtcaagcaattttaacttatcgattgaacacatatgcc
aaccttggtgactacacttgtcctaattgtgattttgaacgtccaaaccttgattatgcc
ttaacaaggctaacacatctgacaaatacttcatcaggtttcgttattgatggccaacaa
tataatatcaacgtgggtggcctttataatatttacaatgctttggcggcagtatctgtt
gctgaatattttggtgtagaaccaagtcaaattaaggatggatttgataaaagccgtgcc
gtttttggtcgtcaagaaacctttacaattggaaataaaaaatgtactttagttctgatt
aaaaatccggtaggagctagtcaagctcttgatatgattaaacttgctccatacccgttc
tctctctcagtactactgaatgccaattatgctgacggtattgatacttcttggatttgg
gacgctaattttgaaactattctcacgatgaatatcccagaaatatttgctggtggtgtt
cgccactctgaaattgctcgtcgcttacgtgtaactggttatgatgagaaacgcataaaa
caagctgataaactgcaagatattatgacaatgattgagcagcaagagactgagcatgct
tatattttagcaacatatacagctatgctggagtttcgtgaaattcttgctaaccacaac
gctatcagaaaggagatgaattaa

DBGET integrated database retrieval system