KEGG   Streptococcus agalactiae GD201008-001 (serotype Ia): A964_0919Help
Entry
A964_0919         CDS       T02248                                 

Gene name
pfk
Definition
(RefSeq) 6-phosphofructokinase
  KO
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
sgc  Streptococcus agalactiae GD201008-001 (serotype Ia)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:sgc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    A964_0919 (pfk)
   01230 Biosynthesis of amino acids
    A964_0919 (pfk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    A964_0919 (pfk)
   00030 Pentose phosphate pathway
    A964_0919 (pfk)
   00051 Fructose and mannose metabolism
    A964_0919 (pfk)
   00052 Galactose metabolism
    A964_0919 (pfk)
  Energy metabolism
   00680 Methane metabolism
    A964_0919 (pfk)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    A964_0919 (pfk)
Enzymes [BR:sgc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     A964_0919 (pfk)
Protein phosphatases and associated proteins [BR:sgc01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     A964_0919 (pfk)
Messenger RNA biogenesis [BR:sgc03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     A964_0919 (pfk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
960711..961733
Genome map
AA seq 340 aa AA seqDB search
MKRIAVLTSGGDAPGMNAAIRAVVRKAISEGMEVYGINQGYYGMVTGDIFPLDANSVGDT
INRGGTFLRSARYPEFAELEGQLKGIEQLKKHGIEGVVVIGGDGSYHGAMRLTEHGFPAV
GLPGTIDNDIVGTDYTIGFDTAVATAVENLDRLRDTSASHNRTFVVEVMGRNAGDIALWS
GIAAGADQIIVPEEEFNIDEVVSNVRAGYAAGKHHQIIVLAEGVMSGDEFAKTMKAAGDD
SDLRVTNLGHLLRGGSPTARDRVLASRMGAYAVQLLKEGRGGLAVGVHNEEMVESPILGL
AEEGALFSLTDEGKIVVNNPHKADLRLAALNRDLANQSSK
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtattgctgttttaactagtggtggtgacgcccctggtatgaacgctgctatc
cgtgcagttgttcgtaaagcaatttctgaaggtatggaagtttacggcatcaaccaaggt
tactatggtatggtgacaggggatattttccctttggatgctaattctgttggggatact
atcaaccgtggaggaacgtttttacgttcagcacgttatcctgaatttgctgaacttgaa
ggtcagcttaaagggattgaacagcttaaaaaacacggtattgaaggtgtagtagttatc
ggtggtgatggttcttatcatggtgctatgcgtctaactgagcacggtttcccagctgtt
ggtttgccgggtacaattgataacgatatcgttggcactgactatactattggttttgac
acagcagttgcgacagcagttgagaatcttgaccgtcttcgtgatacatcagcaagtcat
aaccgtacttttgttgttgaggttatgggaagaaatgcaggagatatcgctctttggtca
ggtatcgctgcaggtgcagatcaaattattgttcctgaagaagagttcaatattgatgaa
gttgtctcaaatgttagagctggctatgcagctggtaaacatcaccaaatcatcgtcctt
gcagaaggtgttatgagtggtgatgagtttgcaaaaacaatgaaagcagcaggagacgat
agcgatcttcgtgtgacgaatttaggacatctgctccgtggtggtagtccgacggctcgt
gatcgtgtcttagcatctcgtatgggagcgtacgctgttcaattgttgaaagaaggtcgt
ggtggtttagccgttggtgtccacaacgaagaaatggttgaaagtccaattttaggttta
gcagaagaaggtgctttgttcagcttgactgatgaaggaaaaatcgttgttaataatccg
cataaagcggaccttcgcttggcagcacttaatcgtgaccttgccaaccaaagtagtaaa
taa

DBGET integrated database retrieval system