KEGG   Streptococcus agalactiae GD201008-001 (serotype Ia): A964_1020Help
Entry
A964_1020         CDS       T02248                                 

Gene name
pyrB
Definition
(GenBank) aspartate carbamoyltransferase
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
sgc  Streptococcus agalactiae GD201008-001 (serotype Ia)
Pathway
sgc00240  Pyrimidine metabolism
sgc00250  Alanine, aspartate and glutamate metabolism
sgc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sgc00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    A964_1020 (pyrB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    A964_1020 (pyrB)
Enzymes [BR:sgc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     A964_1020 (pyrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace TMEM154
Motif
Other DBs
NCBI-ProteinID: AFS45788
Position
complement(1063767..1064690)
Genome map
AA seq 307 aa AA seqDB search
MNHQTQTLSLEHFVSLEELSNQEVMSLIKRSIEVKENPSNIGFDKDYYVSNLFFENSTRT
HKSFEMAELKLGLKTIEFNADTSSVNKGETLYDTILTMSALGLDVCVIRHPDIDYYKELI
ASPNIHSAIVNGGDGSGQHPSQSLLDLVTIYEEFGYFKGLKIAIVGDLTHSRVAKSNMQV
LKRLGAEIFFSGPKEWYSSQFDEYGQYLPIDQLVDQIDVLMLLRVQHERHDGKGVFSKES
YHQQFGLTKERYKHLRDTAIIMHPAPVNRDVEIASDLVEADKARIVKQMSNGVYARIAIL
EAVLNSR
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgaatcatcaaacacaaacactttcattagaacattttgtcagtttagaagaattatca
aatcaagaagttatgtctttgataaagagaagtatcgaagttaaagaaaatcctagcaac
attggttttgataaagattactatgtgtcaaatctcttttttgagaattcaacaagaaca
cataagtcatttgaaatggcagaactcaaattaggattaaaaacaattgaatttaatgct
gatacaagttctgttaataaaggagaaaccctttatgatactatcttaacaatgagtgct
ctaggattggacgtttgtgtcattaggcaccctgatattgactattataaagaattgatt
gctagtccgaacattcattcagctattgtcaatgggggtgatggctcaggccaacatcca
agccaatcacttttggatttggtaactatttacgaagaatttggatacttcaaaggacta
aaaattgcgattgtaggagatctaactcactcacgggtagctaaatctaacatgcaagtg
ctaaaacgattaggagctgaaattttcttttctggacccaaagaatggtatagtagtcag
ttcgatgaatatgggcaatatttaccaatagatcagttagttgatcaaattgatgtcctt
atgcttttacgtgttcaacacgaacgtcatgatggtaaaggggtgttttcaaaagaaagc
tatcatcaacaatttggtcttacaaaagaacgctataaacatttaagggatacagcaatt
attatgcacccagcacccgtcaatagggatgtagagattgctagcgatttagtagaagca
gataaggctcgaatagtgaaacagatgagtaatggcgtctatgcaaggatagctatctta
gaagcagtgctcaatagcagataa

DBGET integrated database retrieval system