KEGG   Streptococcus agalactiae GD201008-001 (serotype Ia): A964_1228Help
Entry
A964_1228         CDS       T02248                                 

Gene name
folA
Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
sgc  Streptococcus agalactiae GD201008-001 (serotype Ia)
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:sgc00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:sgc00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1271619..1272113)
Genome map
AA seq 164 aa AA seqDB search
MTKQIIAIWAEDEDHLIGVNGGLPWRLPKELHHFKETTMGQALLMGRKTFDGMNRRVLPG
RETIILTKDEQFQADGVTVLNSVEQVIKWFQEHNKTLFIVGGASIYKAFLPYCEAIIKTK
VHGKFKGDTYFPDVNLSEFKVISRDYFEKDEQNAHAFTVTYFEK
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgacaaagcaaataattgccatttgggctgaagatgaagaccatttgattggagttaat
ggcggtttaccatggaggcttcctaaagagttacatcacttcaaagaaacgaccatgggg
caggctttgcttatgggacgaaagacctttgatggaatgaaccgtcgtgttttacctggt
agagagacaatcatcttaacaaaagatgaacaattccaagcagatggagtgacagtccta
aatagtgttgaacaagttataaaatggtttcaggaacataataagaccttatttattgta
ggtggtgcaagtatttataaagcatttctgccttattgtgaagcaatcataaaaactaaa
gttcatggaaaatttaaaggtgatacctattttcctgatgttaatctatctgagtttaaa
gttatctctagagattattttgaaaaggatgagcagaatgctcatgcttttactgtgaca
tattttgaaaaataa

DBGET integrated database retrieval system