KEGG   Streptococcus agalactiae GD201008-001 (serotype Ia): A964_1353Help
Entry
A964_1353         CDS       T02248                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
sgc  Streptococcus agalactiae GD201008-001 (serotype Ia)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sgc00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    A964_1353 (malQ)
Enzymes [BR:sgc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     A964_1353 (malQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1399448..1400944)
Genome map
AA seq 498 aa AA seqDB search
MKKRASGVLMHITSLPGDLGIGTFGREAYAFVDFLVETDQKFWQILPLTTTSFGDSPYQS
FSAVAGNTHLIDFDLLTLEGFISKDDYQNISFGQDPEVVDYAGLFEKRRPVLEKAVKNFL
KEERATRMLSDFLQEEKWVTDFAEFMAIKEHFGNKALQEWDDKAIIRREEEALAGYRQKL
SEVIKYHEVTQYFFYKQWFELKEYANDKGIQIIGDMPIYVSADSVEVWTMPELFKLDRDK
QPLAIAGVPADDFSDDGQLWGNPIYNWDYHKESDFDWWIYRIQSGVKMYDYLRIDHFKGF
SDYWEIRGDYQTANDGSWQPAPGPELFATIKEKLGDLPIIAENLGYIDERAERLLAGTGF
PGMKIMEFGFYDTTGNSIDIPHNYTENTIAYAGTHDNEVINGWFENLTVEQKAYAENYMR
RLPNEPITETVLRTLYATVSQTTITCMQDLLDKPADSRMNMPNTVGGNWQWRMRKEDLTE
NRKAFLKEITTIYNRGNK
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaacgtgcaagtggtgtcttaatgcacatcacttctctaccaggtgatttaggt
attggaacatttggacgagaagcctacgcttttgttgattttttggtcgaaactgatcaa
aaattttggcaaattcttcccttaacaacaacaagcttcggggactctccttaccagtct
ttttctgcagtagctggtaatacacatttaattgattttgatttgctaacgcttgaaggt
tttatttcgaaagatgactaccaaaatattagttttggacaggatccagaagttgttgat
tatgctggtctgtttgaaaaacgtcgtccagttttagaaaaagcagttaaaaacttcttg
aaagaagagagagctacgagaatgctatctgattttttgcaagaagaaaaatgggtaact
gattttgctgaatttatggctatcaaagaacattttggtaataaggcgcttcaagaatgg
gatgacaaggctattatacgccgtgaagaagaagccttagcaggatatcgtcaaaagctt
agtgaagtgataaaatatcatgaagtaacgcaatatttcttttacaaacaatggtttgag
ttaaaagaatatgctaatgataaagggattcaaattatcggtgatatgccaatctacgtt
tctgccgatagtgtagaagtttggacaatgcctgaactgtttaaattagatcgtgacaaa
caaccacttgctattgctggtgtaccagcggatgatttttctgacgatggtcagctttgg
ggcaatcctatttacaattgggattaccacaaagagtcagattttgactggtggatttat
cgtattcaatctggtgttaagatgtatgactatttgcgtattgatcattttaaaggtttt
tcagattattgggaaattcgaggagattatcaaacagctaatgatggctcatggcaacca
gctcccggtccagaattatttgcaactatcaaagaaaaattaggtgatttacctattatt
gctgagaatttaggctatattgatgagagagcagagagattactggctggaacagggttc
ccaggtatgaaaatcatggaattcggtttttatgatacaacaggaaatagtattgatatt
cctcataactacacagaaaatacaattgcatatgctggaactcatgataacgaagttatt
aatggctggtttgaaaatcttacagtcgaacagaaagcttatgcagaaaattacatgcgt
cgtttgccaaatgagcccattactgagactgtactacgtaccttgtatgcaaccgttagt
caaacaacgattacatgtatgcaagatctactagataaacctgcagatagccgtatgaac
atgccaaataccgttggaggtaactggcaatggcgtatgagaaaagaagacttaacagaa
aatcgcaaagcattcttaaaagagattacaactatttataatagagggaataaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system