KEGG   Streptococcus agalactiae GD201008-001 (serotype Ia): A964_1628Help
Entry
A964_1628         CDS       T02248                                 

Gene name
recD
Definition
helicase
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
sgc  Streptococcus agalactiae GD201008-001 (serotype Ia)
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:sgc00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    A964_1628 (recD)
Enzymes [BR:sgc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     A964_1628 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1666295..1668715
Genome map
AA seq 806 aa AA seqDB search
MEVFFTGTIERIIFENASNFFKILLLEIEDTDSDFDDVEVIITGTMADVIEGEEYTFWGT
LTQHPKYGEQLQSVRYERAKPTSGGLVKYFSSEQFKGIGKKTAQRIVELYGDNTIDKILE
SPEQLSTISGLSKINREAFIAKLKLNYGTEQVLAKLAEYGLSNRAAIQIFDHYKEESLEV
INENPYQLVEDIQGIGFKIADQLAEQVGIESDSPKRFRAAIIHTLVESSMEQGDTYIEAR
TLLEKTITLLEEARQIELDPSIVAKELTNLIAEDKVQHIGTKIFSNTLFFAEEGIKKNLQ
RILNQPLDKQLNHKDIDREIRDIQKSLNIHYDNIQEKAIREALLSKVFILTGGPGTGKTT
VINGIIEAYSELHHIDLNKNDIPIVLAAPTGRAARRMNELTGLPSATIHRHLGLNGDSDY
QSLDDYLDCSLIIIDEFSMVDTWLANQLFDALDSHTQVIIVGDSDQLPSVGPGQVLADLL
NINALPHVKLEKIFRQSEESTIVTLANQMRQGFLPEDFTAKKADRSYFEASANIIPNMIS
KIVQSALKSGIEAHEIQILAPMYRGQAGINNLNLIMQNLLNPLKDNNQFTFNDINFRIGD
KVLHLVNDTELNVFNGDIGYITDLIPAKYTESKQDEIYMTFDGQEVIYQRKEWLKITLAY
AMSIHKSQGSEFQVVILPITRQSGRMLQRNLIYTAITRSKSKLILLGEIGAFDFAVKNEG
AKRNTYLIERFENKQEIANSQKIEDSSIDQKIDNTIINTSIPKTATPIEQTNLSKITYRL
TEENYLTIDPMIGINQQDISAIFDSK
NT seq 2421 nt NT seq  +upstreamnt  +downstreamnt
atggaagtattttttacaggaaccattgaacgcattatatttgaaaatgccagcaatttt
tttaaaatattacttctggaaatcgaagatacggatagcgattttgatgatgtagaagta
attattactggtactatggccgacgttatagagggagaagaatatactttttggggaaca
ctaacccaacatccaaaatacggcgagcaactacaaagtgtacgctatgaaagagccaag
cctacttcaggtggccttgtgaaatacttttctagcgaacaatttaaaggaattggtaaa
aagactgcccaacgcatcgtagaactctatggagataataccattgataaaatccttgaa
tcccctgaacagttaagtacaatctcaggactatcaaaaattaatagagaagcattcatc
gctaaactgaaactcaattatggaacagagcaagttttagctaaactcgctgaatatggg
ttaagcaatcgtgctgctattcaaatatttgatcactataaagaagaatcacttgaagtg
ataaacgaaaatccttatcaacttgttgaggatatccaaggtatcggttttaaaatagct
gaccaacttgctgaacaagtcggtattgaaagtgattctcctaaacgctttcgtgctgct
attattcatactttagttgagtcttctatggagcaaggagatacctatattgaggctcgt
actctcttggaaaaaaccattactctccttgaagaagctcgtcaaatcgaactagatcct
tcaattgttgctaaggaattgacaaatttaattgcagaagataaagtgcaacatattgga
actaaaatttttagtaatactctattttttgccgaagaaggcatcaaaaaaaacttacaa
cgaatactaaatcagcctcttgataaacaactaaatcacaaagatattgaccgtgaaatc
agagatattcaaaaatctttaaatatccactacgataatatccaagaaaaagctattaga
gaagctttactaagtaaggtatttatcttgactggtggcccaggaacaggtaaaacaaca
gttataaatggtattattgaagcctattccgagttacatcatattgatttaaacaaaaat
gatattcctattgtacttgctgctcctacaggtcgtgctgctagacgcatgaatgaactt
accggtttaccgagtgctactattcataggcatttgggattaaacggagatagtgactat
caaagtctagatgactatctagattgttccttaattatcattgatgaattttcaatggtt
gacacttggcttgctaatcaattatttgacgctttggactcgcacacacaagttattatt
gtcggagatagtgatcaattaccgtctgtaggtccaggacaagttctagcagatctttta
aatataaatgcacttccacacgttaaacttgaaaagatttttagacaatcagaagaatca
actattgtgactttagctaatcaaatgagacagggctttttgccagaggactttacagct
aaaaaagccgatcgctcatactttgaagcatctgctaatatcatcccaaatatgatttct
aaaattgttcaatctgcacttaagagcggtattgaagctcatgaaattcaaattttagct
cctatgtatcgcggccaagcaggtattaataatcttaaccttatcatgcaaaatctcctc
aatccattaaaagataataaccaatttacttttaatgatataaatttccgaataggagat
aaagtgttacatttagtcaacgatacagagcttaatgtttttaatggggatattggttac
ataacggaccttataccagccaaatatactgagagcaagcaagatgagatttatatgact
tttgacggtcaagaagttatctatcaacgcaaagaatggcttaaaataacactagcctat
gctatgagtattcataaatcacagggttctgaatttcaagttgttattctgccaataacg
agacagagtggtcgaatgttacagcgaaaccttatttatacagctattacgagatctaaa
agtaaactaatacttttaggagaaattggtgcatttgatttcgctgttaaaaacgagggg
gcaaagcgcaatacttatctgatagaaagatttgaaaacaagcaagaaatagctaattct
caaaaaattgaagatagctcaatagatcaaaagattgacaacacaataattaatacgtcc
attccaaaaacagcaacaccaattgagcagactaatctttcaaaaataacttatcgccta
actgaagaaaattatttaacaatcgatccaatgattggtattaatcaacaagatataagt
gcaatttttgatagtaaataa

DBGET integrated database retrieval system