KEGG   Streptococcus gallolyticus subsp. gallolyticus ATCC BAA-2069: SGGBAA2069_c00970Help
Entry
SGGBAA2069_c00970 CDS       T01444                                 

Gene name
ipk
Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
sgg  Streptococcus gallolyticus subsp. gallolyticus ATCC BAA-2069
Pathway
sgg00900  Terpenoid backbone biosynthesis
sgg01100  Metabolic pathways
sgg01110  Biosynthesis of secondary metabolites
sgg01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sgg00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SGGBAA2069_c00970 (ipk)
Enzymes [BR:sgg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     SGGBAA2069_c00970 (ipk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_C GHMP_kinases_N DUF1788
Motif
Other DBs
NCBI-ProteinID: CBZ47269
Position
106798..107646
Genome map
AA seq 282 aa AA seqDB search
MAIIEKAPAKINLGLDIIGKRPDGYHDLSMIMVSVDLNDYITVSEIDGSEIVVESNNHKM
PLNDKNDVFKAAKLIREICQIDSGVKIELKKSIPICAGLGGGSTDAAATIRALDKLWQLN
LSKDEMIDVGFQIGSDVPYCLEAGCACISGKGEIVECLDYQLSAWVVLVKPEFGVSTRTV
FPEIDCKTISRVDIASLREAVLAKDYEKMIAYMGNSLEDITIKRKPFIQKIKDRMMNCGA
DVALMTGSGPTVYALCRSEKKADRLVNSMRGFCKEVYKVRIL
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atggctattattgagaaggcaccagctaagattaatttggggctagatattattggaaaa
cgaccggatggttatcatgatttatctatgattatggttagtgttgatttgaatgactat
attacggtttctgaaattgatggaagtgagattgtggttgagtctaataatcataaaatg
cccttgaatgataaaaatgacgtttttaaggctgctaaattgattcgtgagatttgtcag
attgattcaggggttaagattgagttgaaaaaatcaattcctatttgtgctggcctaggt
ggtggttcaacagatgctgctgctacaattcgagctttggataaattatggcagcttaat
ctttctaaggatgaaatgattgatgttggatttcaaattgggagtgatgttccgtactgt
ctggaggcaggttgtgcgtgtatttctggtaagggagagattgtagaatgtcttgattat
caattatcagcttgggttgttttggtgaaacctgagtttggtgtttcaacacgtacggtt
tttcctgaaattgattgtaagacgatttcacgtgtagatatcgcttcgttacgagaggcg
gtgcttgctaaggattacgaaaaaatgattgcatatatgggaaattctttggaggatatt
accattaagcgcaagccatttattcaaaaaatcaaggatcggatgatgaattgtggagca
gatgttgctttgatgacgggaagtggtccgacagtttatgctttgtgtcgttcggaaaaa
aaagccgatcgtctggtcaatagtatgcgtggcttttgtaaggaagtttacaaggttcgt
attttatag

DBGET integrated database retrieval system