KEGG   Streptococcus gallolyticus subsp. gallolyticus ATCC BAA-2069: SGGBAA2069_c01550Help
Entry
SGGBAA2069_c01550 CDS       T01444                                 

Gene name
galM
Definition
(GenBank) aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
sgg  Streptococcus gallolyticus subsp. gallolyticus ATCC BAA-2069
Pathway
sgg00010  Glycolysis / Gluconeogenesis
sgg00052  Galactose metabolism
sgg01100  Metabolic pathways
sgg01110  Biosynthesis of secondary metabolites
sgg01120  Microbial metabolism in diverse environments
sgg01130  Biosynthesis of antibiotics
Module
sgg_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:sgg00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SGGBAA2069_c01550 (galM)
   00052 Galactose metabolism
    SGGBAA2069_c01550 (galM)
Enzymes [BR:sgg01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     SGGBAA2069_c01550 (galM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim PBP5_C
Motif
Other DBs
NCBI-ProteinID: CBZ47327
Position
166929..167960
Genome map
AA seq 343 aa AA seqDB search
MEVKQEIVETINGQKVEKYTIVNDNGVQVGLLTLGATWQEFLVPDDKGGQKNLIIGFDKP
SDYLKNPLCAGQSIGRVAGRINQGKVNLDGKEIQLPQNEKGNTLHGGSQGFHQQIWTAFI
EAGQNALSVVMTYDAKEEIDHFPGDMQVEVRFTLDNANRFTIVYTGKNATKTTLFNPTNH
VYFNLGNRQDLSQHTFTLAADHYLETRDDLIPTGKFIDVAGTAYDFQTGQNLGEAIADTG
GLDDAFLVNASLDKTCGELKDDESGDSVHLYSDRDAWVVYSMGGIPEGIYPARDKGKMAK
EFEALALEAQFLPDAINHDNFGDITLQANEEKSYTIAFEYHKE
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atggaagtcaaacaagaaattgttgagacaattaatgggcaaaaggttgaaaaatacact
attgttaatgataatggtgtccaagttggtttactaacgctgggagcaacttggcaagaa
tttttagtgccagatgacaaaggtggtcagaaaaatcttatcattggttttgataagccg
agtgattatctgaaaaatcctttatgtgcaggtcaatcaatcggacgtgttgcagggcgt
attaatcaagggaaagttaaccttgatggcaaagaaattcagctaccacaaaacgaaaaa
ggaaacactcttcacggtggctctcaaggatttcatcagcaaatctggactgcatttatc
gaagctggtcaaaatgcgcttagtgtggtgatgacttatgacgctaaagaggaaattgac
catttcccaggagatatgcaggtagaagtacgatttacgctagacaatgcaaatcgtttt
acgattgtttatacgggcaaaaatgctactaaaacaacgctttttaacccaactaaccat
gtttattttaacttgggaaatcgtcaagatttaagtcagcacaccttcactttggcagct
gaccattatttagagactcgtgatgatttgattccgacaggaaaattcattgacgttgct
ggcacagcttatgattttcaaactgggcaaaaccttggagaggctatcgctgatacaggc
gggcttgacgatgctttcttggtaaatgcttcgcttgataaaacttgtggagaattgaaa
gatgatgaaagtggcgattctgttcacctttattctgaccgtgatgcttgggtcgtttac
agcatgggtggcattcctgaaggtatttatccagcgcgtgataagggcaaaatggctaaa
gaatttgaagccttagcgcttgaagcacaatttctcccagatgctattaatcatgataat
tttggtgacattaccctgcaagcaaatgaggagaaaagctacacaattgcttttgagtat
cataaagaataa

DBGET integrated database retrieval system