KEGG   Streptococcus gallolyticus subsp. gallolyticus ATCC BAA-2069: SGGBAA2069_c02090Help
Entry
SGGBAA2069_c02090 CDS       T01444                                 

Gene name
aga
Definition
alpha-galactosidase AgaN (EC:3.2.1.22)
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
sgg  Streptococcus gallolyticus subsp. gallolyticus ATCC BAA-2069
Pathway
Galactose metabolism
Glycerolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:sgg00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:sgg00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
221776..223953
Genome map
AA seq 725 aa AA seqDB search
MGITIKGNLFYIQSKEMSMIIENREGDLLLRHIGGKIANYHGSNAIFEKDHAFSGNPTPD
NRTFSYDTQRQIFGVHGFGDFRCPSLKIQHDNNELTQFKLKDSHILHGVVEATGLPSPHS
MEGAETLVFILEDEFAKLRLTLYYTAYADRATISTFAKISNLSDKAVIINRALSTMLDVP
AGNYDVVTLQGAYAREKTVRRQMVEQGIFSIASNRGASGHAQTPAVILCDRTATEDAGSA
LALQLLYSGNFQAFVQKNQLNEVRLGIGINDDNFAWQLAARDNFETPVALMTYSAKGLTH
LSQESQLFVQNHIMPKQFAHVERPILINNWEATYFAFKQEKLLDLVDEASRLGIELFVLD
DGWFGNRFDDNRALGDWGVNEEKLGGPLSDLIDKVHAKGLKFGLWFEPEMISVDSDLYRT
HPDWAIQAEGRAHTYSRNQLVLNLANPDVVAYIKLAIDKILTENAIDYVKWDYNRNITNI
GNGDSALATKMQSHAYMLGLYDLVSYLTGKHSNILFESCSGGGGRNDLGMMRYFPQVWAS
DNTDAISRLQIQYGSSYLYPTISMGSHVSASPNHQMGRTTPIETRGNVAMMGNLGYELDL
TSLPESEKEVIATQVSHYKDIRPVVQFGKHYRLINPEQGANEAAVQFVYEDKVVVTYVRT
LSMIETIETTLKLKGLEEADTYRLQETGQVFSGAELMYAGLTVTLPQGDYLSKQYYFVKQ
KGGFQ
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
gtgggaattacaatcaaaggaaatcttttctatattcagagtaaagagatgtcaatgatt
attgagaatcgagaaggtgatttacttcttcgtcatattgggggtaaaatcgctaactat
cacggttcaaatgcgatatttgagaaagatcatgctttttcaggcaatccgactcccgat
aatcgtacgtttagctatgatacccaacgtcaaatctttggtgtgcatggctttggtgat
tttcgttgcccatcacttaaaattcaacatgataacaatgaattaacacaatttaagtta
aaagatagtcatattttacatggagttgttgaggcaacaggattacctagtcctcattca
atggaaggtgctgaaacattagtgtttatcttagaagatgaatttgctaaattgcgtctg
acgctttattacacagcttatgcagatcgtgcaactatttcaacctttgctaagattagt
aatctatccgataaagctgttatcatcaaccgtgctttatcaactatgcttgatgtacct
gctggaaattatgatgtggtgactttgcaaggagcttatgcgcgtgagaaaacagttcgt
cgtcaaatggtcgagcaaggtatctttagcattgcttcaaatcgcggagcttctggtcat
gctcagactccagctgtgattttgtgtgataggacagcgacggaggatgctggcagtgcc
cttgctttgcagctactttatagtggtaattttcaagcttttgttcaaaaaaatcaattg
aatgaagttcgcttagggattggtattaatgatgataactttgcttggcaattggcagct
agagataattttgaaacgccagtggctttgatgacttattcggcaaaaggtttgacacac
ttgagccaagaaagccagttgtttgtgcaaaatcatatcatgccaaaacaatttgctcat
gttgagcgtccgattcttatcaataactgggaagcgacttattttgctttcaagcaagaa
aaattgcttgatttagttgatgaagcaagcagacttggtattgaactctttgttttagat
gacggttggtttggaaatcgatttgacgataatcgtgcacttggtgactggggtgtcaat
gaagaaaaactcggtggaccattgagtgatttgattgataaagttcatgctaaaggcttg
aaatttggtttgtggtttgaaccggaaatgatttctgtagatagtgacctttaccgtacc
catcctgattgggctattcaagctgagggtcgtgctcatacttattctcgtaatcaattg
gtacttaaccttgccaaccctgatgtggtagcttatattaaattagctatcgataaaatc
ttgacagaaaatgctattgattatgtcaaatgggattataaccgtaacatcacaaatatc
ggaaatggcgactcagctcttgccactaagatgcaatcccatgcatatatgttaggtttg
tatgatttggtatcctatttgactggaaaacatagcaatattctctttgaatcatgctca
ggtggcggtggtcgaaacgaccttggaatgatgcgctacttcccacaagtttgggctagt
gataatacagatgccatttctcgtttgcaaattcaatatggttcaagctatctgtaccca
actatctctatgggttcccatgtttcagcaagcccaaatcaccaaatgggacgcacaaca
ccaattgaaacacgtggaaatgttgctatgatgggaaatcttggctacgaacttgatttg
acaagcctaccagaaagtgaaaaagaagtgattgctactcaggtttctcactacaaagac
attcgtccagttgtccaatttgggaagcattatcgtcttatcaatccagaacaaggcgca
aatgaagcggctgtgcaatttgtctatgaagataaagtcgttgtaacttacgttcgcaca
ctttcaatgattgaaacaattgaaacgacgctaaaactgaaaggtttagaggaagcagat
acctatcgcttacaagaaacaggacaagttttctccggggctgaactcatgtatgcaggt
ttgaccgtaactctcccacaaggtgactatctcagcaaacaatactattttgtgaaacaa
aaaggaggttttcaatga

DBGET integrated database retrieval system