KEGG   Streptococcus gallolyticus subsp. gallolyticus ATCC BAA-2069: SGGBAA2069_c02130Help
Entry
SGGBAA2069_c02130 CDS       T01444                                 

Gene name
gtfA
Definition
sucrose phosphorylase (EC:2.4.1.7)
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
sgg  Streptococcus gallolyticus subsp. gallolyticus ATCC BAA-2069
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:sgg00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SGGBAA2069_c02130 (gtfA)
Enzymes [BR:sgg01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     SGGBAA2069_c02130 (gtfA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
227335..228780
Genome map
AA seq 481 aa AA seqDB search
MGIQNKTMLITYSDSLGKNLKELKQNLDKYFGEAVGGIHLLPFFPSTGDRGFAPVDYDEV
DSTFGTWDDVKGLGENYYLMFDFMINHISRQSKYYKDYQEKHEASAYKDMFLNWDKFWPE
NRPTQVDVDLIYKRKDRAPKQEIHFTDGSVEHLWNTFGEEQIDLDVTKEVTMDFIRKTIK
HLAENGCDLIRLDAFAYAVKKLDTNDFFVEPDIWELLDKVRSIAAESGTELLPEIHEHYS
IQFKIAEHDYYVYDFALPMVTLYSLYSRKVDRLAKWLKMSPMKQFTTLDTHDGIGVVDVK
DILTDDEIDYTSSELYKVGANVKRKYSSAEYNNLDIYQINSTYYSALGDDDKKYFLARLI
QVFAPGIPQVYYVGFLAGKNDLDLLEKTKEGRNINRHYYTNEEIAEEVRRPVVQALLKLF
TFRNQSAAFDLDGSIDVEILDENTLVITRRNQGSSVVAEAQINLKELSYAVKENGEEVTF
L
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgggaattcaaaataaaacaatgttaatcacttactcggatagtctgggtaaaaattta
aaagaacttaaacaaaatcttgataagtatttcggggaggcagttggtggtatccatcta
ttgccattctttccgtcaactggtgaccgtggttttgcccctgtcgattatgatgaggta
gattctacatttggtacttgggatgatgtgaaaggcttgggtgaaaactattatcttatg
tttgatttcatgattaaccatatttctcgtcaatcaaaatattacaaagattatcaagaa
aaacatgaagctagtgcttacaaggatatgtttcttaactgggataaattttggccagaa
aatcgtccgacacaagttgatgtggacttgatttacaagcgtaaagaccgcgcaccaaaa
caagaaattcattttacagatggttcggttgagcatttgtggaatacatttggtgaggaa
caaattgaccttgacgtgacaaaagaagtgaccatggatttcattcgaaaaaccatcaaa
cacctagcagaaaatggatgtgacctcattcgtctagatgcatttgcttatgcagttaag
aaattggataccaatgatttctttgtggagccagacatttgggaattacttgataaagtg
cgtagcattgcagcggaatctggtacagaattgcttccagaaattcatgagcactattca
atccagtttaagattgctgagcatgactattatgtctatgattttgcacttccaatggtg
acgctttatagcctatatagcagaaaagttgaccgtttggcaaaatggttgaaaatgtcg
ccgatgaagcaatttacaacgcttgatacacatgatggaattggtgtggttgatgtcaaa
gatattttgacagatgatgaaattgattatacctccagtgaactttataaagttggtgct
aatgtcaaacgtaaatactcatctgctgaatacaataatctcgatatttatcagattaat
tcgacttattattctgcacttggtgatgatgacaagaaatatttcttagcacgcttgatt
caggtttttgccccgggtattccacaagtttattatgttggatttttagcaggaaaaaat
gatcttgatttgttagaaaaaacaaaagaaggccgcaacatcaatcgtcattattacacg
aatgaagaaattgctgaagaagtccgacgcccagtagttcaagctttgctcaaactcttt
acttttcgaaatcaatcagctgcttttgaccttgatggcagtattgatgtagagatatta
gatgaaaatacgcttgtaatcactcgccgtaatcaaggtagcagtgtggttgcggaagcc
caaattaatttaaaagagttaagctacgcagttaaagaaaacggggaagaagttactttc
ttataa

DBGET integrated database retrieval system