KEGG   Streptococcus gallolyticus subsp. gallolyticus ATCC BAA-2069: SGGBAA2069_c03990Help
Entry
SGGBAA2069_c03990 CDS       T01444                                 

Gene name
proB1
Definition
glutamate 5-kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
sgg  Streptococcus gallolyticus subsp. gallolyticus ATCC BAA-2069
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:sgg00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SGGBAA2069_c03990 (proB1)
  Amino acid metabolism
   00330 Arginine and proline metabolism
    SGGBAA2069_c03990 (proB1)
Enzymes [BR:sgg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     SGGBAA2069_c03990 (proB1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
428486..429289
Genome map
AA seq 267 aa AA seqDB search
MKRNFETVNRIVIKIGTSSLVMPNGKINLEKIDQLAFVISSLMNKGKDVILVSSGAMGFG
LNVLNMDKRPTEIARQQAVSSVGQVAMMSLYSQIFSHYQTEVSQLLITRDVIEYPESLEN
FTNAFEMLLTMGIVPIVNENDAISVDEMDHTTKFGDNDRLSAIVAKVTKADLLIMLSDID
GLYDKNPNIYDDAKLREHVTEITDEIIKSAGGAGSKFGTGGMLSKIKSAQMIFDNNSQMI
LMNGANPRDILKALEGANIGTWFSQVN
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgaaattttgaaactgttaatcgaattgttataaaaattgggacaagctcgctt
gtcatgccaaatggcaaaattaatcttgaaaaaattgaccaactagcttttgttatctct
agcttgatgaataaaggaaaagatgttattttggtgtcatctggtgccatgggatttggg
ctcaatgtgttaaatatggacaaacgtccgacagaaattgcacgtcaacaggcggtgtca
agtgttgggcaggttgccatgatgagcctttattctcaaatcttttcgcattatcagaca
gaagttagtcagctgttgattacacgtgatgttattgaatatcctgaaagcttagaaaat
ttcactaatgcctttgaaatgttattaacaatgggaattgtgccaatcgttaacgaaaac
gatgctattagcgttgatgaaatggaccacacgacaaaatttggtgataatgaccgactt
tcagcgattgtagccaaggtaaccaaagcagatttgttaatcatgttatcagatattgac
ggactttacgataaaaatccaaatatctatgatgatgccaaacttcgcgaacacgttact
gaaattacggacgaaatcattaaatcagcgggcggtgctggaagtaaatttggcacggga
ggcatgctcagcaagattaagagtgctcaaatgatttttgacaataacagtcagatgatt
ttgatgaacggtgcaaatccgcgtgatattttaaaagctctagaaggtgctaatattgga
acgtggttttcacaagtgaattaa

DBGET integrated database retrieval system