KEGG   Streptococcus gallolyticus subsp. gallolyticus ATCC BAA-2069: SGGBAA2069_c04240Help
Entry
SGGBAA2069_c04240 CDS       T01444                                 

Gene name
gmk
Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
sgg  Streptococcus gallolyticus subsp. gallolyticus ATCC BAA-2069
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:sgg00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
455678..456295
Genome map
AA seq 205 aa AA seqDB search
MTERGLLIVFSGPSGVGKGTVRQEIFSTPDHKFEYSVSMTTRQKRPGEVDGVDYFFRTRE
EFEELIKNGQMLEYAEYVGNYYGTPLTYVNETLDKGIDVFLEIEVQGALQVKKKVPDGVF
IFLTPPDLDELKDRLVGRGTDSEEVIRQRIERAKEEIALMREYDYAVVNDEVPLAAERVK
RIIEAEHFRVDRVIGRYNDMIKDID
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaacgtggtttgttaattgttttctcaggaccttctggggttggtaagggaaca
gttcgccaagaaattttttcaacaccagatcataaatttgaatattccgtttctatgaca
acacgccaaaaacggccaggagaagtcgatggcgttgattatttcttccgaactcgtgaa
gaatttgaggagcttattaaaaatggtcaaatgttggaatatgctgaatacgtaggaaac
tactatggcacaccactgacttatgttaatgaaactcttgataaagggattgatgtgttc
cttgaaatcgaagtgcaaggagcgcttcaagttaagaagaaagttccagatggggtgttt
attttcttaacgccacctgatttggacgaattaaaagatcgtttggtaggacgtggtaca
gatagcgaagaagttatccgtcaacgtattgaacgtgctaaagaagaaatcgctttgatg
cgtgagtatgattatgctgttgttaacgatgaagtgcctttggcagctgaacgcgttaaa
cgcattatcgaagcagaacatttccgtgttgatcgtgttatcggacgatataacgacatg
attaaagatattgattaa

DBGET integrated database retrieval system