KEGG   Streptococcus gallolyticus subsp. gallolyticus ATCC BAA-2069: SGGBAA2069_c05230Help
Entry
SGGBAA2069_c05230 CDS       T01444                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase subunit beta
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
sgg  Streptococcus gallolyticus subsp. gallolyticus ATCC BAA-2069
Pathway
sgg00260  Glycine, serine and threonine metabolism
sgg00400  Phenylalanine, tyrosine and tryptophan biosynthesis
sgg01100  Metabolic pathways
sgg01110  Biosynthesis of secondary metabolites
sgg01130  Biosynthesis of antibiotics
sgg01230  Biosynthesis of amino acids
Module
sgg_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sgg00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SGGBAA2069_c05230 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SGGBAA2069_c05230 (trpB)
Enzymes [BR:sgg01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SGGBAA2069_c05230 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: CBZ47695
Position
555640..556842
Genome map
AA seq 400 aa AA seqDB search
MSYNQPDTNGFYGKFGGQFVPETLMTAVIELDEAYREAKADPSFQEELDALLKNYVGRET
PLYYAERLTKHIGGAKIYLKREDLNHTGAHKINNALGQVLLAKRMGKKKIIAETGAGQHG
VATATAAALFDMECTIYMGEEDVKRQALNVFRMELLGAKVFSVTDGSRVLKDAVNAALRA
WVANIEDTHYIMGSALGPAPFPEMVRDFQSVIGQEAKEQYAEISGGKLPDAVLACVGGGS
NAIGLFYPFVEDESVALYGAEAAGHGLDTEEHAATFAKGRIGILHGALMNVLQDRHGQIM
EAFSISAGLDYPGVGPEHCHFKDIGRATYDSITDDEALEAFMLLSRLEGIIPALESSHAI
ALTQKVAKELGPDKSIIVCLSGRGDKDVVQVKERLEAEGK
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgagctataaccaaccagatactaatggattttacggaaaatttggtggacaatttgtt
cccgaaacgctgatgactgcggttatcgaacttgatgaagcttaccgcgaagctaaggca
gacccaagctttcaagaagaactcgatgcgcttttgaaaaattatgtcggtcgtgaaaca
ccgctttattatgcagagcgtttaacaaaacatatcggcggtgcgaaaatttacctcaaa
cgtgaagaccttaaccacacaggtgctcataaaattaataatgccctcggtcaagttctc
cttgctaaacgaatgggcaaaaagaaaatcattgccgaaactggtgctggtcaacacggg
gttgcaacagcaacagcagctgcactttttgacatggaatgtacgatttacatgggtgaa
gaggacgtgaaacgccaagcactcaatgttttccgtatggaattgctaggcgctaaagtc
ttttctgtaactgatggttcacgcgttttgaaagatgccgtaaatgcagcccttcgcgcg
tgggtagctaatatcgaagatacacactacatcatggggtcagctctcggacctgcacct
ttccctgaaatggttcgtgacttccaatctgttatcggtcaagaagcaaaggaacaatat
gcagagatttcaggaggaaaattgcctgatgctgtcctagcctgtgttggcggtggttca
aatgcgattggtcttttctatccatttgtcgaagatgaatcagttgctctttacggtgct
gaagcagcaggacatgggcttgatactgaagaacacgctgcaacatttgccaaaggacgt
ataggtattttgcatggtgctttgatgaatgttttgcaagaccgtcatggacaaatcatg
gaagctttctcaatctcagctggtcttgattatccaggcgttggtccagaacattgccat
tttaaagacattggtcgtgcaacatacgattctattaccgatgatgaagcacttgaagca
ttcatgcttctatcacgtttggaagggattattccggccctcgaatcaagtcatgccatt
gctttgactcaaaaagtggctaaggaattaggaccagataaatcaatcattgtttgtcta
tctggacgtggtgataaggatgttgtgcaagtaaaagaacgtttggaagcagaagggaaa
tag

DBGET integrated database retrieval system