KEGG   Streptococcus gallolyticus subsp. gallolyticus ATCC BAA-2069: SGGBAA2069_c05300Help
Entry
SGGBAA2069_c05300 CDS       T01444                                 

Gene name
glcK
Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
sgg  Streptococcus gallolyticus subsp. gallolyticus ATCC BAA-2069
Pathway
sgg00010  Glycolysis / Gluconeogenesis
sgg00052  Galactose metabolism
sgg00500  Starch and sucrose metabolism
sgg00520  Amino sugar and nucleotide sugar metabolism
sgg00521  Streptomycin biosynthesis
sgg01100  Metabolic pathways
sgg01110  Biosynthesis of secondary metabolites
sgg01120  Microbial metabolism in diverse environments
sgg01130  Biosynthesis of antibiotics
sgg01200  Carbon metabolism
Module
sgg_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
sgg_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sgg00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SGGBAA2069_c05300 (glcK)
   00052 Galactose metabolism
    SGGBAA2069_c05300 (glcK)
   00500 Starch and sucrose metabolism
    SGGBAA2069_c05300 (glcK)
   00520 Amino sugar and nucleotide sugar metabolism
    SGGBAA2069_c05300 (glcK)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SGGBAA2069_c05300 (glcK)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    SGGBAA2069_c05300 (glcK)
Enzymes [BR:sgg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     SGGBAA2069_c05300 (glcK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG Hexokinase_1
Motif
Other DBs
NCBI-ProteinID: CBZ47702
Position
560798..561766
Genome map
AA seq 322 aa AA seqDB search
MTKKLLGIDLGGTTIKFGILTLEGEVQEKWAIDTNILEDGKHIVPDIVESIKHRLNLYGL
TKDDFVGIGMGSPGAVDRAKKTVTGAFNLNWAHTEEVGSVIERELGIPFAIDNDANVAAL
GERWTGAGANNPDVVFVTLGTGVGGGVIADGNLIHGVAGAGGEIGHMNVEPVDGFECTCG
NKGCLETVASATGVVRVARHLAEEYEGDSSIKAAIDNGDAVTSKDIFVAAEAGDHFADSV
VEKVGFYLGQATANIANILNPDSVVIGGGVSAAGEFLRSRVEKYFVSYAFPQVRKTTKIK
IAELGNDAGIIGAASLASQFVD
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgactaaaaaacttttagggattgaccttggtgggacaacgattaaattcggtatccta
acacttgagggagaagtgcaagaaaaatgggcaattgacacgaatatccttgaagatggt
aaacacattgtccctgatattgttgaatcaatcaaacaccgtttgaatctttacggtttg
acaaaagatgattttgtaggtatcggtatggggtctccaggtgctgttgatcgcgctaaa
aaaacagttacaggtgccttcaacttgaactgggcacacactgaagaagtcggttcagtt
atcgaacgtgaacttggcattccatttgctattgataacgatgcaaacgtagctgcactt
ggtgaacgttggacaggtgctggcgcaaacaatccagatgttgtttttgtaacacttgga
actggtgttggtggcggtgttatcgctgacggtaaccttatccacggtgtcgctggtgct
ggtggagaaattggtcacatgaatgttgaaccagttgatggatttgaatgtacttgtggt
aacaaaggttgtctagaaacagttgcttcagcaacaggtgttgtgcgtgtggctcgtcat
ttggctgaagaatacgaaggtgattcaagcatcaaagctgccattgacaatggtgatgcg
gtgacaagtaaagacatctttgtcgctgctgaagcgggtgaccattttgccgattcagtt
gttgaaaaagttggtttctatcttggtcaagcaacagcaaatatcgcaaacatcttgaac
ccagattcagttgttatcggcggtggtgtttcagctgcaggtgaattcttgcgtagtcgc
gttgaaaaatattttgtcagttacgctttcccacaagtgcgcaaaacaacaaaaatcaaa
attgccgaacttggaaatgatgctggtatcattggtgcagcaagtcttgcaagtcaattt
gtagattaa

DBGET integrated database retrieval system