KEGG   Streptococcus gallolyticus subsp. gallolyticus ATCC BAA-2069: SGGBAA2069_c05300Help
Entry
SGGBAA2069_c05300 CDS       T01444                                 

Gene name
glcK
Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
sgg  Streptococcus gallolyticus subsp. gallolyticus ATCC BAA-2069
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sgg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SGGBAA2069_c05300 (glcK)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SGGBAA2069_c05300 (glcK)
   00052 Galactose metabolism
    SGGBAA2069_c05300 (glcK)
   00500 Starch and sucrose metabolism
    SGGBAA2069_c05300 (glcK)
   00520 Amino sugar and nucleotide sugar metabolism
    SGGBAA2069_c05300 (glcK)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SGGBAA2069_c05300 (glcK)
   00524 Butirosin and neomycin biosynthesis
    SGGBAA2069_c05300 (glcK)
Enzymes [BR:sgg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     SGGBAA2069_c05300 (glcK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
560798..561766
Genome map
AA seq 322 aa AA seqDB search
MTKKLLGIDLGGTTIKFGILTLEGEVQEKWAIDTNILEDGKHIVPDIVESIKHRLNLYGL
TKDDFVGIGMGSPGAVDRAKKTVTGAFNLNWAHTEEVGSVIERELGIPFAIDNDANVAAL
GERWTGAGANNPDVVFVTLGTGVGGGVIADGNLIHGVAGAGGEIGHMNVEPVDGFECTCG
NKGCLETVASATGVVRVARHLAEEYEGDSSIKAAIDNGDAVTSKDIFVAAEAGDHFADSV
VEKVGFYLGQATANIANILNPDSVVIGGGVSAAGEFLRSRVEKYFVSYAFPQVRKTTKIK
IAELGNDAGIIGAASLASQFVD
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgactaaaaaacttttagggattgaccttggtgggacaacgattaaattcggtatccta
acacttgagggagaagtgcaagaaaaatgggcaattgacacgaatatccttgaagatggt
aaacacattgtccctgatattgttgaatcaatcaaacaccgtttgaatctttacggtttg
acaaaagatgattttgtaggtatcggtatggggtctccaggtgctgttgatcgcgctaaa
aaaacagttacaggtgccttcaacttgaactgggcacacactgaagaagtcggttcagtt
atcgaacgtgaacttggcattccatttgctattgataacgatgcaaacgtagctgcactt
ggtgaacgttggacaggtgctggcgcaaacaatccagatgttgtttttgtaacacttgga
actggtgttggtggcggtgttatcgctgacggtaaccttatccacggtgtcgctggtgct
ggtggagaaattggtcacatgaatgttgaaccagttgatggatttgaatgtacttgtggt
aacaaaggttgtctagaaacagttgcttcagcaacaggtgttgtgcgtgtggctcgtcat
ttggctgaagaatacgaaggtgattcaagcatcaaagctgccattgacaatggtgatgcg
gtgacaagtaaagacatctttgtcgctgctgaagcgggtgaccattttgccgattcagtt
gttgaaaaagttggtttctatcttggtcaagcaacagcaaatatcgcaaacatcttgaac
ccagattcagttgttatcggcggtggtgtttcagctgcaggtgaattcttgcgtagtcgc
gttgaaaaatattttgtcagttacgctttcccacaagtgcgcaaaacaacaaaaatcaaa
attgccgaacttggaaatgatgctggtatcattggtgcagcaagtcttgcaagtcaattt
gtagattaa

DBGET integrated database retrieval system