KEGG   Streptococcus gallolyticus subsp. gallolyticus ATCC BAA-2069: SGGBAA2069_c05330Help
Entry
SGGBAA2069_c05330 CDS       T01444                                 

Gene name
galA
Definition
alpha-galactosidase (EC:3.2.1.22)
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
sgg  Streptococcus gallolyticus subsp. gallolyticus ATCC BAA-2069
Pathway
Galactose metabolism
Glycerolipid metabolism
Brite
KEGG Orthology (KO) [BR:sgg00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    SGGBAA2069_c05330 (galA)
  Lipid metabolism
   00561 Glycerolipid metabolism
    SGGBAA2069_c05330 (galA)
   00600 Sphingolipid metabolism
    SGGBAA2069_c05330 (galA)
Enzymes [BR:sgg01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     SGGBAA2069_c05330 (galA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(563306..565513)
Genome map
AA seq 735 aa AA seqDB search
MSITKINNIFHLSNTDMSYLIKIMPNGQLEQLYFGPTLVLKEDDFSLLEHSEGKAAGTVK
YAKNSSFTLADKHQECALYGTTAFQEASLEVTVHDTPHYLELKYLDYDTQKEKLSYSGPH
VRLNDDTEILSLRLEDAGLQLQVTLEYVFFKKGKNISKRVLINNNGQHDIVLTRALSSTF
WLEDANDYQAYHFSGAWISERQLKKYPLQQGSFKVESLTGTSSHQHNPFVAIAKKETTFD
TGMCYGANLVYSGNFIQQIDVNEWNQARLMSGISPYTFSWQLKPNENFATPQTVLSFSQD
GLNGLAQENADFISEHIISPFWAKRERPIVLNSWETYVFDFDENKLLTLAKEAAALGIEC
FVVDDGWFAKRNNDRSSLGDWYPNPEKFPNGLQVFAQKIHQMGLQFGLWFEPEMVNEDTE
LYRKHPDWIVEPPQGRYSYGRGQLVLDFTNPAVVENIFEQMSRIIDETQLDYLKWDMNRN
LTEVYSNYLAKNGIRQGEFFHRYVQGVYQLYEKLLERYPNLLIEGCASGGGRFDLGILYY
SPQIWVSDNTDAIARLDIQENTALAYPITCLSNHVSQVPNGQIQRITPLETRFNVAIFGI
LGYELDLLSLDEHSKNIIKQQITLYKNLRHDIMTGRFYQVLKRPNQHIWALQSPQIILIG
YFSILADINQSTSKTFTLPFVDSQTTYDIVDNQTVSGSLLKYRGIPVPIALNGTNQETAA
LVGDFQSKLLLLRKH
NT seq 2208 nt NT seq  +upstreamnt  +downstreamnt
atgtcaattacaaaaataaacaatatttttcacttgtcaaatactgatatgagttacctc
atcaaaatcatgccaaatggacaacttgaacaactgtattttggtccaacattagtgcta
aaagaagatgacttttcccttttagaacactcagaaggcaaagctgctggcactgttaaa
tatgccaaaaatagcagttttacattagctgataaacatcaagaatgtgccctttatggg
acaacggctttccaagaagcttcacttgaagtgaccgtccatgataccccacactattta
gagttaaaataccttgattacgatactcaaaaagaaaagctctcctattctggaccacat
gtcagactaaatgatgacactgaaatattaagccttagactagaagatgcggggttgcaa
ttacaagtcactttagaatatgtcttttttaaaaaaggaaaaaatatcagcaaacgcgtc
cttattaacaacaatggacaacatgatattgtcttaacacgcgcactctcctcaaccttt
tggctagaagatgccaacgactatcaggcttatcatttttcaggtgcttggatttcagaa
cgtcaattaaaaaaatacccacttcaacaaggaagttttaaagtcgaaagtttaactggt
acaagtagtcatcaacacaatccctttgtcgctattgccaaaaaagaaacgacttttgac
acaggcatgtgttatggagcaaacttggtttattctggtaatttcattcaacaaatcgat
gttaatgaatggaatcaagcaagattaatgagtgggatttcaccttatactttttcttgg
caactaaaaccaaatgaaaattttgcaacaccgcaaactgttttaagttttagtcaagat
ggtctcaatggcttagcacaagaaaacgctgattttatttctgaacatatcatttctcca
ttctgggcaaaacgagagcgaccaattgtactaaatagctgggagacttacgtttttgat
ttcgatgaaaacaagcttttaacccttgctaaagaagccgcagcattaggtattgaatgt
tttgtcgttgatgatggctggtttgctaaacgcaacaacgaccgctcatcattaggtgat
tggtacccaaatcctgaaaaatttccaaatggattacaagtatttgcccaaaaaattcac
caaatggggttacaatttggtctttggtttgaacccgaaatggttaacgaggataccgag
ctttatcgcaagcatcctgattggattgttgagccaccacaaggacgttattcatacggt
cgtggtcaattagtgcttgactttaccaatccagctgttgtcgaaaatatttttgaacaa
atgtctcgaattatcgatgaaacacaactagattatctcaaatgggatatgaaccgaaat
ttaaccgaagtttattccaattatctcgccaaaaacggcatcagacaaggagaatttttc
catcgctatgttcaaggtgtttatcaattatacgaaaaattacttgaacgttacccaaat
ctcctcattgaaggttgtgcatcagggggcggacgatttgatttaggtattctttattat
agccctcaaatctgggttagcgacaataccgatgcgattgccagattggatattcaagaa
aatactgctcttgcctacccaatcacttgcctatctaaccatgtctctcaagttccaaat
ggtcaaattcaacgtattacccctttagaaacacgtttcaatgttgccatttttggaatt
cttggctatgaactggatttattaagtttagacgaacactcaaaaaatattataaaacag
cagattacactgtacaaaaaccttagacatgacatcatgactggacgtttctaccaagtt
ctgaagcgtccaaaccagcacatttgggcgcttcaaagtccacaaatcattttgattggg
tacttttcaatcctagctgatattaatcaaagtaccagcaaaacatttacccttcctttt
gtagattctcaaactacatatgatattgtggacaatcaaactgttagtggcagtctgttg
aaatatcgtggtatacctgttccaatcgccctaaacggaactaatcaagaaactgctgct
ttggttggtgattttcaatcaaaacttctcctcctcagaaaacattga

DBGET integrated database retrieval system