KEGG   Streptococcus gallolyticus subsp. gallolyticus ATCC BAA-2069: SGGBAA2069_c05950Help
Entry
SGGBAA2069_c05950 CDS       T01444                                 

Gene name
recR
Definition
recombination protein recR
Orthology
K06187  
recombination protein RecR
Organism
sgg  Streptococcus gallolyticus subsp. gallolyticus ATCC BAA-2069
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:sgg00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    SGGBAA2069_c05950 (recR)
DNA repair and recombination proteins [BR:sgg03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      SGGBAA2069_c05950 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
628005..628601
Genome map
AA seq 198 aa AA seqDB search
MLYPTPIAKLIDSFTKLPGIGIKTATRLAFYTIGMSDEDVNEFAKNLLAAKRELTYCSVC
GNLTDEDPCNICTDETRDHSVILVVEDSKDVSAMEKIQEYHGLYHVLHGLISPMNGVGPD
DINLKSLITRLMDSEVNEVIIATNATADGEATSMYISRVLKPAGIKVTRLARGLAVGSDI
EYADEVTLLRAIENRTEL
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgctttatccaacacctatcgcaaagctgattgatagttttacaaaattaccaggaatt
ggtataaaaacagcaacacgtttggctttctacacgattggaatgtcagatgaagatgtg
aatgaattcgccaaaaatttattggcagctaagcgtgaattgacttattgttccgtttgt
gggaatttaacagatgaagacccttgtaatatctgtacagatgaaactcgtgatcattcc
gttattttagtggttgaagattcaaaagacgtatctgccatggaaaaaattcaagagtat
catggcttgtaccatgtcttgcatggcttgatttcaccaatgaacggtgtcggaccagat
gatattaatttgaaatcattgattacacgtttaatggatagtgaggtcaatgaagtgatt
attgcaaccaatgcaaccgcagacggtgaagcaacatctatgtatatctcacgtgtccta
aaaccagcaggaatcaaggtaacacgtttagcacgtggactggctgttggctcagacatc
gaatacgctgacgaagtcaccctacttcgtgctatcgaaaatcggacagaattgtag

DBGET integrated database retrieval system