KEGG   Streptococcus gallolyticus subsp. gallolyticus ATCC BAA-2069: SGGBAA2069_c07540Help
Entry
SGGBAA2069_c07540 CDS       T01444                                 

Gene name
glgB
Definition
glycogen branching protein (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
sgg  Streptococcus gallolyticus subsp. gallolyticus ATCC BAA-2069
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:sgg00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
795969..797870
Genome map
AA seq 633 aa AA seqDB search
MDTKEALRTFGTGENFHAQHYFGFHKETRNGTEGYSFRVWAPNAQSVHLIGDFTQWRENP
LAMERNEAGVWEIFTDLPKENQLYKYLVKRSTGQEVEKLDPFAIYFEKRPGTAAVLTDFP
EKKWKDALWLGRRKRFGFRNRPVNIYEVHAGSWKQHDDGRPYQFKELTEELIPYLVKMNY
THVEFMPLMAHPLGMSWGYQLMGYFAFEHSYGTPEDFQNFVEACHLNNIGVIVDWVPGHF
TINDDALAYFDGTPTFEYEDEDRAHNRGWGALNFDLGKNQVQSFLISSAKFWIDYYHLDG
IRVDAVSNMLYRDYDIGPWTPNKDGGNRNYEGYYFLQKLNAVLKNFYPDIMMIAEESTSD
TKITGPIEYDALGFDYKWNMGWMNDILKFYEEDPIYRKYDFNLVTFSFMYAFSENFILPF
SHDEVVHGKKSLMHKMWGDRYNQFAGLRNLYTYQICHPGKKLLFMGSEFGQFLEWKYDYQ
LEWVNLEDDLNKKMQDFTSQLNAFYKEHNVLWQIDDSYDGIEIIDADNTDQTVLSFIRKN
KDGDMLICVFNMVPVERKDFTIGVPVAGIYEEVWNTEMEEFGGVWKEHNLQARTQDRLWK
NYHHTLSFTLPALGASIWKIKRRLAKQIPKKGK
NT seq 1902 nt NT seq  +upstreamnt  +downstreamnt
atggacacgaaagaggcactgagaacttttggaacgggtgaaaattttcatgcgcaacat
tactttggctttcataaagaaactcgtaatggtaccgaaggttacagttttagagtctgg
gcacccaacgctcaatctgttcatctgattggtgatttcactcaatggagagaaaatccg
cttgctatggaacgcaacgaagcaggtgtatgggaaatttttacggatttacctaaagaa
aatcaactttacaagtatcttgtaaaacgttcgactggtcaagaagttgaaaaattagac
ccatttgctatttatttcgaaaagcgaccagggacagcagcagttcttacagattttcca
gaaaagaagtggaaagatgcactttggttagggcgacgcaaacgtttcggtttccgtaat
cgtcctgttaatatctatgaagtgcatgcaggttcatggaaacaacatgatgatggtcgt
ccttatcaatttaaggaattaacagaagaattgattccttatttggttaagatgaattac
acgcacgttgaattcatgccgttaatggcacatccgcttgggatgagttggggttaccaa
ctaatggggtactttgctttcgagcatagttatggaacgccagaggatttccaaaatttt
gttgaagcttgtcatttgaataatatcggtgtcattgtggactgggttccaggacatttt
acgattaatgatgatgctttggcttattttgacggaacgccaacgtttgagtacgaggat
gaagaccgagctcataaccgcggttggggcgctctaaattttgaccttggaaaaaatcaa
gttcagtctttcttaatttctagtgccaagttttggatagattattatcacttagatggt
attcgagtggatgccgtaagtaacatgctgtatcgtgactatgatattggaccttggaca
ccaaataaagatggtggtaaccgtaattatgaggggtattatttcttacaaaaactaaat
gccgttttgaaaaatttttatcctgatatcatgatgattgctgaagaaagtaccagtgac
actaaaattacaggtcctattgaatacgatgcgctcggctttgattataaatggaatatg
ggatggatgaatgatattttgaaattctatgaagaagaccccatttatcgtaagtatgat
tttaatctcgtcacatttagttttatgtatgctttttctgaaaactttatcctaccattc
tcacacgatgaagtggttcacggtaagaaaagtttaatgcataaaatgtggggtgaccgt
tacaatcaatttgctgggcttcgtaatctttatacctatcaaatctgtcatccaggcaaa
aaattgctctttatgggaagcgaatttggtcaattccttgaatggaaatatgactatcag
ctagagtgggttaatttggaagatgacttaaacaagaaaatgcaagatttcacaagtcaa
ctgaatgcattctacaaagagcacaatgtcttgtggcaaatagatgatagctatgacggt
atcgaaatcattgatgcagacaatactgaccagaccgttctatccttcattcgtaaaaac
aaagatggcgatatgttaatttgtgtgtttaacatggtgcccgttgaacgtaaagacttt
acaattggagttccagttgcaggcatttacgaagaagtttggaatacagaaatggaagaa
tttggtggtgtctggaaagaacataatctccaagctcgcacacaagatagactttggaag
aattaccatcatacgttaagtttcaccttacctgcactcggtgccagtatatggaaaata
aaacgacgtttggcaaaacagattcctaagaaaggaaaatag

DBGET integrated database retrieval system