KEGG   Streptococcus gallolyticus subsp. gallolyticus ATCC BAA-2069: SGGBAA2069_c09980Help
Entry
SGGBAA2069_c09980 CDS       T01444                                 

Gene name
bglA1
Definition
beta-glucosidase (EC:3.2.1.21)
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
sgg  Streptococcus gallolyticus subsp. gallolyticus ATCC BAA-2069
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:sgg00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1044987..1046405
Genome map
AA seq 472 aa AA seqDB search
MLHKNLKPFPEHFLWGASTSAYQVEGAALEDGKGPSCQDVKEIPAGTADLSVSVDHYHHY
KEDIALMAEMGFKSYRFSISWTRVLPNGTGEVNPKGIEFYNNLIDECLKYDIEPIVTMFH
FDMPAALDERGSWSTHDSVDWFAEYARVLFENFGDRVKYWLTINEQNMLTLVGPVIGTLH
VPEGTTNLTKEIYQQNHHQLVAQAKAMQLCHEMLPDAKIGPAPNISLVYPASSKPEDVIA
AQNFNALRNWLYLDAYVFGEYNNLAWAYLEENDALPTVTDEDRAIMKAAKPDFIGFNYYN
TATVEASDGSEVAGANGDQQSNQTFPGFAKSVDNPNLVKTEFGWEIDPVGFRATVREMYS
RYRLPLLVTENGLGAYDTLTEDGKIHDNYRIEYLRQHIAQIQLAISDGVDMLGYNPWSAI
DLISTHEGIRKRYGFIYVDRTDEEVGSLKRYRKDSFFWYKKVIAANGQDLSD
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgttacacaaaaatttaaaaccatttccagaacattttttgtggggagcttcaacgtca
gcttatcaagttgaaggggctgctttagaggacggcaaaggtccgtcatgccaagacgtg
aaagaaattcctgcaggaacagctgatttgtcagtttcagttgaccattatcatcattac
aaagaagatattgctctaatggcagaaatgggcttcaaatcatatcgcttctccatttct
tggacacgtgttttgccgaatggaacaggcgaggttaatccaaaagggattgaattctac
aataatttgattgacgaatgtttgaaatatgacattgaaccaatcgtcacaatgttccac
tttgatatgccagcggcgcttgatgaacgtggttcttggtcaacacatgattctgttgat
tggttcgctgaatatgcgcgtgtcttgtttgaaaacttcggtgaccgtgttaaatattgg
ctaacaatcaatgaacaaaatatgctaacattggttggtccagttatcggtacgcttcat
gtaccagaaggaacaactaatctcactaaagagatttaccaacaaaatcatcaccaattg
gttgcgcaagctaaagcaatgcaactttgccatgaaatgcttcctgatgctaaaattggt
ccagcaccaaatatttctttggtttacccagcgtcatcaaaaccagaagatgttattgct
gctcaaaacttcaatgcgcttcgtaattggctttatttagatgcttatgttttcggtgaa
tacaataacctagcttgggcatatttggaagaaaatgatgctttgccaacggttactgat
gaagaccgtgctatcatgaaagcagctaaacctgattttattggctttaactattacaat
acagcgactgttgaagcttctgacggtagtgaagtcgcaggagctaatggcgaccaacaa
tcaaatcaaactttcccaggctttgcgaagagtgttgacaatccaaatcttgtgaaaaca
gaatttggttgggaaattgaccctgttggtttccgtgcaactgttcgtgaaatgtacagc
cgttaccgtttgccacttttagtcactgagaatggtcttggagcttatgatactttgaca
gaagatggcaaaattcacgataactatcgtatcgaataccttcgccaacacattgcacaa
atccaattggctatttctgacggtgttgatatgcttggttacaatccatggtcggcaatc
gacctcatctcaacacacgaaggtatccgtaaacgttatggctttatttacgttgaccgt
acggatgaagaagtaggcagcctcaaacgctaccgcaaagattccttcttctggtacaag
aaagtcattgccgcaaatggacaagatttgtcagattga

DBGET integrated database retrieval system