KEGG   Streptococcus gallolyticus subsp. gallolyticus ATCC BAA-2069: SGGBAA2069_c14190Help
Entry
SGGBAA2069_c14190 CDS       T01444                                 

Gene name
malM
Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
sgg  Streptococcus gallolyticus subsp. gallolyticus ATCC BAA-2069
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sgg00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SGGBAA2069_c14190 (malM)
Enzymes [BR:sgg01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     SGGBAA2069_c14190 (malM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1473041..1474582)
Genome map
AA seq 513 aa AA seqDB search
MKKRASGVLMHITSLPGKQGVGTFGQEAYDFVDFLVETDQTYWQILPLTTTSYGDSPYQS
FSATAGNTHLIDLELLSEQGYLDKKDFETVNFGDDLESVDYARIFELRRPILEKAVKAFL
SQKENVEALAEFEKDTSWLQDFADFMAIKEFFDNKALQEWDDKAVVRREEKALETYRAKL
KDAILYHKVTQYFFYQQWAKLKAYANENGIEIIGDMPIYVSADSVEVWTMPELFKVDSDK
NPLCIAGVPADEFSDDGQLWGNPIYDWKNHAKTNYAWWVYRIQEGFKLYDLLRIDHFKGF
SDYWEIRGDYETANDGSWEPGPGRALFDVVKDELGDLPIIAENLGYIDAKAEQLLTDTAF
PGMKILEFGFYDTEGKSIDAPHNCNKNSVAYTGTHDNEVINGWYDNLTDEQKAFVNAYTH
RNDDEPIAQAMLRTLFATVSDVAIATMQDLLDKPADSRMNIPNTVGGNWQWRMLKEDLTD
ERKAFLKDITALYCRKNTFKTTIKEEKETKNDN
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaacgtgcaagtggtgtattgatgcatatcacatcgctacctggaaagcaaggg
gtgggaacattcggacaagaagcctatgactttgttgatttcttagttgaaactgaccaa
acatactggcaaattttaccactaacaacgacaagttatggtgattccccttatcaatcg
ttctcagctactgcggggaatacgcatctgattgaccttgaactccttagtgaacaaggt
taccttgataaaaaagattttgaaaccgttaattttggtgatgatttagagtctgttgac
tacgctcgtatttttgaattgcgccgtcctattttggaaaaagccgtcaaagccttcttg
agccaaaaggaaaatgttgaagctttagctgaatttgaaaaagatactagctggctccaa
gattttgcagatttcatggcaattaaagaattttttgataacaaagctctacaagaatgg
gatgataaagcggttgttagacgagaagaaaaagctcttgaaacttaccgtgctaaatta
aaagacgctattctttaccataaagtcactcaatatttcttctatcaacaatgggctaag
ctcaaagcttatgctaatgaaaatgggattgaaattattggtgatatgccaatttacgtt
tcagctgatagtgttgaagtatggacaatgcctgaactgttcaaagtagatagtgataaa
aatccactttgcattgctggtgttcctgcggatgaattcagcgatgatggtcagctttgg
ggaaatccaatttatgattggaaaaaccatgctaagacaaattatgcttggtgggtttac
cgtattcaagaaggtttcaaattgtatgaccttcttcgtattgaccatttcaaaggtttc
tcagattattgggaaatccgtggtgactacgaaacagcaaatgacggtagttgggaacca
ggtccaggacgtgctttgtttgatgttgtcaaagacgaacttggcgaccttccaattatt
gctgaaaaccttggttacatcgatgcaaaagctgaacagttgttgacggatacagctttt
ccaggcatgaagattcttgaatttggcttctatgacaccgaaggaaagagtattgatgct
cctcataactgtaataaaaatagcgttgcttatacaggaacacacgataatgaagttatc
aacggttggtatgacaacttgactgacgagcaaaaagcatttgtgaatgcttacactcac
cgtaatgacgatgaaccgattgcacaagctatgcttcggacattgtttgcgactgttagt
gatgttgcgattgcgacaatgcaagatctacttgataaaccagctgatagccgcatgaat
attccaaatactgttggtggcaactggcaatggcgtatgcttaaagaagatttgacagat
gagcgcaaagctttcttgaaagatattacagcactttactgccgcaaaaatacatttaaa
acgacaattaaagaagaaaaggaaactaaaaatgacaactaa

DBGET integrated database retrieval system