KEGG   Streptococcus gallolyticus subsp. gallolyticus ATCC BAA-2069: SGGBAA2069_c14930Help
Entry
SGGBAA2069_c14930 CDS       T01444                                 

Gene name
hisD
Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
sgg  Streptococcus gallolyticus subsp. gallolyticus ATCC BAA-2069
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:sgg00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SGGBAA2069_c14930 (hisD)
  Amino acid metabolism
   00340 Histidine metabolism
    SGGBAA2069_c14930 (hisD)
Enzymes [BR:sgg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     SGGBAA2069_c14930 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1550305..1551378)
Genome map
AA seq 357 aa AA seqDB search
MVDQAFEEIDAEVLEALKNAKANIESYHKQQLEKGFEDQPTEGVVRGQLIRPIERVGVYV
PGGTAAYPSSVLMNVIPAKIAGVKEIIMITPPQAHFEPAILVAASLAGVDKIYQVGGAQG
VAALAYGTETIPRVDKITGPGNIFVATAKKLVYGIVGIDMIAGPSEIGVIADDTANPKYV
AADLLSQAEHDVRARAILVTNSAALADAVEKEIEEQLKTLLREEIARASVENNGRIIIAD
SVEAMFELMNQVAPEHLEIAMDNAYDYLDAIENAGSVFLGHFTSEPIGDYYAGANHILPT
TSTSRFSSALGVHDFVKRIQYMQYSKIAVNVASHDITTLAYAEGLQAHARAIEVRHD
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
ttggttgaccaagcgtttgaggaaattgatgccgaggttttggaagctctcaaaaatgcc
aaagcgaatattgaaagttatcacaagcaacagttggaaaaaggatttgaggaccaacca
actgaaggcgttgttcgtgggcaattgattcgtccgattgagcgtgttggggtttatgtc
ccaggtggaactgctgcttatccgtcatctgttttgatgaatgtcattccagctaagatt
gctggtgttaaagaaattatcatgattacaccgccacaagcgcatttcgaacctgcgatt
ttggtggctgcttcgttagctggtgttgataagatttatcaagttggcggggctcaaggt
gtcgctgctttggcatatggtacagaaacgattcctcgtgttgataagattactggacca
ggaaatatttttgttgcgacagctaaaaaactcgtttacggtattgttggtattgatatg
attgcaggtccgtctgaaattggtgtgatcgcagatgacacagccaatccaaaatacgtt
gcagcagatttgctctcacaagctgagcatgatgtgcgtgcgcgtgcgattttggtgaca
aattcagcagcgttagcggatgcggttgaaaaggaaatcgaagaacaacttaaaaccttg
ctacgtgaagaaattgcgcgtgcttctgttgaaaataatggtcgtatcatcattgcagat
tctgttgaggcaatgtttgaattgatgaaccaagtggcgccagaacatttggaaattgct
atggataatgcttatgattatcttgatgcgattgaaaatgcgggttctgttttccttggg
cattttacgagtgaaccaatcggtgattattacgcaggggcaaatcatattttgccaaca
actagcacaagccgtttctcatcagcgctaggtgtgcatgattttgtcaaacgtatccag
tatatgcaatattcaaaaattgctgtgaatgtagctagtcacgatattacaacacttgct
tatgctgaaggattacaagctcatgctagagctattgaggtgcgtcatgactaa

DBGET integrated database retrieval system