KEGG   Streptococcus gallolyticus subsp. gallolyticus ATCC BAA-2069: SGGBAA2069_c14930Help
Entry
SGGBAA2069_c14930 CDS       T01444                                 

Gene name
hisD
Definition
(GenBank) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
sgg  Streptococcus gallolyticus subsp. gallolyticus ATCC BAA-2069
Pathway
sgg00340  Histidine metabolism
sgg01100  Metabolic pathways
sgg01110  Biosynthesis of secondary metabolites
sgg01230  Biosynthesis of amino acids
Module
sgg_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:sgg00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    SGGBAA2069_c14930 (hisD)
Enzymes [BR:sgg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     SGGBAA2069_c14930 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh Imm21
Motif
Other DBs
NCBI-ProteinID: CBZ48665
Position
complement(1550305..1551378)
Genome map
AA seq 357 aa AA seqDB search
MVDQAFEEIDAEVLEALKNAKANIESYHKQQLEKGFEDQPTEGVVRGQLIRPIERVGVYV
PGGTAAYPSSVLMNVIPAKIAGVKEIIMITPPQAHFEPAILVAASLAGVDKIYQVGGAQG
VAALAYGTETIPRVDKITGPGNIFVATAKKLVYGIVGIDMIAGPSEIGVIADDTANPKYV
AADLLSQAEHDVRARAILVTNSAALADAVEKEIEEQLKTLLREEIARASVENNGRIIIAD
SVEAMFELMNQVAPEHLEIAMDNAYDYLDAIENAGSVFLGHFTSEPIGDYYAGANHILPT
TSTSRFSSALGVHDFVKRIQYMQYSKIAVNVASHDITTLAYAEGLQAHARAIEVRHD
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
ttggttgaccaagcgtttgaggaaattgatgccgaggttttggaagctctcaaaaatgcc
aaagcgaatattgaaagttatcacaagcaacagttggaaaaaggatttgaggaccaacca
actgaaggcgttgttcgtgggcaattgattcgtccgattgagcgtgttggggtttatgtc
ccaggtggaactgctgcttatccgtcatctgttttgatgaatgtcattccagctaagatt
gctggtgttaaagaaattatcatgattacaccgccacaagcgcatttcgaacctgcgatt
ttggtggctgcttcgttagctggtgttgataagatttatcaagttggcggggctcaaggt
gtcgctgctttggcatatggtacagaaacgattcctcgtgttgataagattactggacca
ggaaatatttttgttgcgacagctaaaaaactcgtttacggtattgttggtattgatatg
attgcaggtccgtctgaaattggtgtgatcgcagatgacacagccaatccaaaatacgtt
gcagcagatttgctctcacaagctgagcatgatgtgcgtgcgcgtgcgattttggtgaca
aattcagcagcgttagcggatgcggttgaaaaggaaatcgaagaacaacttaaaaccttg
ctacgtgaagaaattgcgcgtgcttctgttgaaaataatggtcgtatcatcattgcagat
tctgttgaggcaatgtttgaattgatgaaccaagtggcgccagaacatttggaaattgct
atggataatgcttatgattatcttgatgcgattgaaaatgcgggttctgttttccttggg
cattttacgagtgaaccaatcggtgattattacgcaggggcaaatcatattttgccaaca
actagcacaagccgtttctcatcagcgctaggtgtgcatgattttgtcaaacgtatccag
tatatgcaatattcaaaaattgctgtgaatgtagctagtcacgatattacaacacttgct
tatgctgaaggattacaagctcatgctagagctattgaggtgcgtcatgactaa

DBGET integrated database retrieval system