KEGG   Streptococcus gallolyticus subsp. gallolyticus ATCC BAA-2069: SGGBAA2069_c15320Help
Entry
SGGBAA2069_c15320 CDS       T01444                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
sgg  Streptococcus gallolyticus subsp. gallolyticus ATCC BAA-2069
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:sgg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SGGBAA2069_c15320 (tpiA)
   01230 Biosynthesis of amino acids
    SGGBAA2069_c15320 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SGGBAA2069_c15320 (tpiA)
   00051 Fructose and mannose metabolism
    SGGBAA2069_c15320 (tpiA)
   00562 Inositol phosphate metabolism
    SGGBAA2069_c15320 (tpiA)
Enzymes [BR:sgg01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     SGGBAA2069_c15320 (tpiA)
Exosome [BR:sgg04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   SGGBAA2069_c15320 (tpiA)
  Exosomal proteins of bladder cancer cells
   SGGBAA2069_c15320 (tpiA)
  Exosomal proteins of melanoma cells
   SGGBAA2069_c15320 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(1593180..1593938)
Genome map
AA seq 252 aa AA seqDB search
MSRKPFIAGNWKMNKNPEEAKAFVEAVASKLPSSELVEAGIAAPALDLSTVLAAAKGSNL
KVAAENCYFENAGAFTGENSPKVLSEMGTDYVVIGHSERREYFHETDEDINKKAKAIFAN
GMLPIICCGETLETYEAGKAAEFVGGQVSAALAGLSEEQVSSLVIAYEPIWAIGTGKSAS
QDDAQKMCKVVRDTVAADFGQAVADKVRVQYGGSVKPENVAAYMACPDVDGALVGGASLQ
PESFLALLDFVK
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgtaaaccatttatcgctggtaactggaaaatgaacaaaaatccagaagaagct
aaagcattcgttgaagcagtagcttctaaattgccttcatcagaacttgttgaagctggt
atcgcagctcctgcacttgacctttcaacagttcttgctgcagctaaaggttcaaacctt
aaagttgctgctgaaaactgctactttgaaaacgctggtgctttcactggtgaaaacagc
cctaaagtattgtctgaaatgggaactgactacgttgtaatcggtcactcagaacgtcgt
gaatacttccacgaaactgacgaagatatcaacaaaaaagctaaagcaatctttgctaac
ggtatgcttccaatcatctgctgtggtgaaactcttgaaacttacgaagctggtaaagca
gctgaattcgtaggtggacaagtttcagctgctcttgctggattgtcagaagaacaagtt
tcttcacttgttattgcatacgaaccaatctgggctatcggtactggtaaatcagctagc
caagatgacgcacaaaaaatgtgtaaagttgttcgtgacacagttgcagcagacttcggt
caagcagtagctgacaaagttcgcgttcaatacggtggttcagttaaacctgaaaacgtt
gcagcttacatggcttgcccagacgttgatggtgcccttgttggtggtgcatcacttcaa
ccagaaagcttccttgctcttcttgactttgtaaaataa

DBGET integrated database retrieval system