KEGG   Streptococcus gallolyticus subsp. gallolyticus ATCC BAA-2069: SGGBAA2069_c15320Help
Entry
SGGBAA2069_c15320 CDS       T01444                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
sgg  Streptococcus gallolyticus subsp. gallolyticus ATCC BAA-2069
Pathway
sgg00010  Glycolysis / Gluconeogenesis
sgg00051  Fructose and mannose metabolism
sgg00562  Inositol phosphate metabolism
sgg01100  Metabolic pathways
sgg01110  Biosynthesis of secondary metabolites
sgg01120  Microbial metabolism in diverse environments
sgg01130  Biosynthesis of antibiotics
sgg01200  Carbon metabolism
sgg01230  Biosynthesis of amino acids
Module
sgg_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
sgg_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:sgg00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SGGBAA2069_c15320 (tpiA)
   00051 Fructose and mannose metabolism
    SGGBAA2069_c15320 (tpiA)
   00562 Inositol phosphate metabolism
    SGGBAA2069_c15320 (tpiA)
Enzymes [BR:sgg01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     SGGBAA2069_c15320 (tpiA)
Exosome [BR:sgg04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   SGGBAA2069_c15320 (tpiA)
  Exosomal proteins of bladder cancer cells
   SGGBAA2069_c15320 (tpiA)
  Exosomal proteins of melanoma cells
   SGGBAA2069_c15320 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: CBZ48704
Position
complement(1593180..1593938)
Genome map
AA seq 252 aa AA seqDB search
MSRKPFIAGNWKMNKNPEEAKAFVEAVASKLPSSELVEAGIAAPALDLSTVLAAAKGSNL
KVAAENCYFENAGAFTGENSPKVLSEMGTDYVVIGHSERREYFHETDEDINKKAKAIFAN
GMLPIICCGETLETYEAGKAAEFVGGQVSAALAGLSEEQVSSLVIAYEPIWAIGTGKSAS
QDDAQKMCKVVRDTVAADFGQAVADKVRVQYGGSVKPENVAAYMACPDVDGALVGGASLQ
PESFLALLDFVK
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgtaaaccatttatcgctggtaactggaaaatgaacaaaaatccagaagaagct
aaagcattcgttgaagcagtagcttctaaattgccttcatcagaacttgttgaagctggt
atcgcagctcctgcacttgacctttcaacagttcttgctgcagctaaaggttcaaacctt
aaagttgctgctgaaaactgctactttgaaaacgctggtgctttcactggtgaaaacagc
cctaaagtattgtctgaaatgggaactgactacgttgtaatcggtcactcagaacgtcgt
gaatacttccacgaaactgacgaagatatcaacaaaaaagctaaagcaatctttgctaac
ggtatgcttccaatcatctgctgtggtgaaactcttgaaacttacgaagctggtaaagca
gctgaattcgtaggtggacaagtttcagctgctcttgctggattgtcagaagaacaagtt
tcttcacttgttattgcatacgaaccaatctgggctatcggtactggtaaatcagctagc
caagatgacgcacaaaaaatgtgtaaagttgttcgtgacacagttgcagcagacttcggt
caagcagtagctgacaaagttcgcgttcaatacggtggttcagttaaacctgaaaacgtt
gcagcttacatggcttgcccagacgttgatggtgcccttgttggtggtgcatcacttcaa
ccagaaagcttccttgctcttcttgactttgtaaaataa

DBGET integrated database retrieval system