KEGG   Streptococcus gallolyticus subsp. gallolyticus ATCC BAA-2069: SGGBAA2069_c15410Help
Entry
SGGBAA2069_c15410 CDS       T01444                                 

Gene name
bsaA
Definition
glutathione peroxidase (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
sgg  Streptococcus gallolyticus subsp. gallolyticus ATCC BAA-2069
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:sgg00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:sgg00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1603320..1603805
Genome map
AA seq 161 aa AA seqDB search
MTNLYDFTVKAQDGSDVQLSKYQGKILLIVNTATGCGLTPQYEGLQKLYDTYHDKGFEIL
DFPCNQFLNQAPGNADEINTFCTLNYQTTFPRFAKIKVNGKEADPLYDWLKSEQKGPLGK
RIEWNFAKFLIDQNGNVIKRFSSKTEPETIVTEIESLINDK
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgactaatctttatgactttactgtcaaagcccaagacggctctgatgtccaattgtca
aaataccaaggcaaaatcctactcattgtcaatacggcaacaggttgtggcttaacccca
caatacgaaggactacaaaaactttatgacacttaccatgacaaaggatttgaaatttta
gattttccttgtaatcaatttttaaatcaagcgccaggaaacgccgacgaaatcaatacc
ttttgcaccttgaattaccagacaacttttcctcgctttgcgaaaattaaagtcaacggt
aaagaagccgacccactctatgattggctaaaaagtgaacaaaagggaccgcttggcaaa
cgtattgaatggaactttgcaaaatttcttatcgaccaaaatggcaatgtcatcaaacgt
ttttcatcaaaaacagaacctgaaacaattgttacagaaattgaaagccttatcaatgac
aaatag

DBGET integrated database retrieval system