KEGG   Streptococcus gallolyticus subsp. gallolyticus ATCC BAA-2069: SGGBAA2069_c16240Help
Entry
SGGBAA2069_c16240 CDS       T01444                                 

Gene name
nagZ
Definition
beta-N-acetylhexosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
sgg  Streptococcus gallolyticus subsp. gallolyticus ATCC BAA-2069
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:sgg00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:sgg00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1686496..1688136)
Genome map
AA seq 546 aa AA seqDB search
MINLTQNPFYLTEEQSAEVIQLANRLTDEEKVGQLFCLLGSIYSDDELNRLVSDYHVSGF
LFRPMPADDLQKKWARLDQLTQIPLLKAANLEEGGYGANEEGTYFANPLQVAATNDLEIT
RKFAKVCAVEGKAAGCNWNFAPVSDIDFNTQNPITNVRTYGSDVQTVVDNVKCYVQTLQQ
NGMAAACKHFPGDGVDYRDQHLHPTYNSLSAEDWYASYGRVYSEAIDVGLLSVMVGHIVQ
PALEKEINAKLEIADMLPASQSKQLLSGILRGKLGFNGLIITDATIMGGYCMSLPRKAAL
TASINAGCDMFCFSTDFYEDYGYLLEALHDGTLSRERLDEAVIRILALKMTLESMSYPQE
TIESIAWRNECADKSITLVKDIQHLIPFDRERFPQIEITVVGEDEIAEGYKISLLAENYF
KSQGFEVSHYHPLEDDLHGTSQLSKDKLRLILVNCPTASNQTTVRINWSPKHALDMPRFV
DEETYAMISFNNPYHLQDAPRVRTYINAYSPTKASVLASFDKMLGYSPFVGVSPIDAFCG
LVDTHL
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
atgattaatttaactcaaaaccccttttatttgaccgaagaacagagtgccgaggttatt
caactggcaaatcgtttaacggatgaagagaaggttggtcaattattttgtttgttaggt
tctatttattcagatgatgagttgaatcgtttggtttctgactatcatgtgagtggtttt
ctctttcgacctatgccagcagacgaccttcagaaaaaatgggctcggctagaccagctc
actcaaattcctcttttaaaagctgcaaatcttgaagaaggcggatacggtgcaaacgaa
gagggtacttattttgccaatcctttacaggttgccgcaactaatgatttagaaatcact
agaaaatttgcaaaagtatgtgctgttgaaggaaaagcagcaggctgtaattggaatttt
gcaccagttagcgatattgatttcaatacccaaaatccgattactaatgttcggacttat
ggttctgatgtgcaaacggtcgttgacaatgtgaaatgctatgtccaaacattgcagcaa
aatggaatggctgcagcttgcaaacattttccaggagacggtgttgattatcgtgaccaa
catttgcaccctacctacaacagtttgtcggcagaagattggtatgctagttacggtcgt
gtttacagcgaagctattgacgtcgggctgttatcagtaatggtaggacatattgttcaa
ccagccttagaaaaagaaattaatgccaaactagaaatcgcagatatgttaccagcaagt
caaagtaagcagctgttatcaggtattctgcgaggaaaacttggttttaatgggcttatc
attacagatgctactattatgggtggctactgtatgtcacttccacgaaaggcagcctta
acggcttctattaatgcaggctgtgatatgttctgtttttcaacggatttttacgaagat
tacggctatttattggaagcattgcatgacggaacactttctcgagaacgcttggatgaa
gcagtcatcagaatcttggctttaaagatgacattagaatcaatgtcctatccacaggaa
actattgagtcgattgcttggcgcaatgagtgtgcggataaatcaattactttggtcaaa
gatattcaacatcttattccgtttgatcgtgaaagatttcctcaaattgaaataaccgtt
gtcggagaagatgagattgctgagggttataaaattagcctactagctgaaaattatttt
aagagccaagggtttgaggttagccattatcatccacttgaagatgacctacatggaact
tcacaattatcaaaggataagttgcgtttgattttggttaactgtcccacagcttccaat
cagacgacggttcggattaattggagcccaaaacacgctcttgatatgcctcgatttgtg
gacgaagaaacttatgctatgatttcgtttaataatccttatcatctccaagatgctcct
cgtgttcgcacatatattaatgcttattcaccaactaaagcaagtgttttagctagtttt
gataaaatgctgggctattcaccatttgtcggtgtaagtcctattgatgctttctgtggt
ttggtggatacacatttgtga

DBGET integrated database retrieval system