KEGG   Streptococcus gallolyticus subsp. gallolyticus ATCC BAA-2069: SGGBAA2069_c16250Help
Entry
SGGBAA2069_c16250 CDS       T01444                                 

Gene name
nagZ1
Definition
beta-N-acetylhexosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
sgg  Streptococcus gallolyticus subsp. gallolyticus ATCC BAA-2069
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sgg00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    SGGBAA2069_c16250 (nagZ1)
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    SGGBAA2069_c16250 (nagZ1)
Enzymes [BR:sgg01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     SGGBAA2069_c16250 (nagZ1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1688153..1689829)
Genome map
AA seq 558 aa AA seqDB search
MVDLKAKPFYLDERAVQWVETTLNNMSLDEKLGQVFIQLAQPDKDYLDEKILGKHVGGIL
FRQNEAKVVQETLRYIQKSSKIPVLFCGNLEEGGIGLAKEGTYFSKQMETIATGNTDFAY
QNGRVLAREASALGCHMSFGPVVDMTIDWRSAITSTNTYGADADQVLKYASANMQGQMDN
GLVTAVKHFPGEGADDHDQHYNCEINEMSIAEWDNVFGKVFQGLIDQGTMSIMPGHIALP
SYQKYYADDMSGQVMPATYSKALLTNLLREKLGFNGLIVSDNTCIAGASNYLPRYQAVPQ
MLMAGIDLILYSFDMDEDLDYLKAALQDGRLTMERLNEAVTRTLAVKASLGLHDKQKEGT
LVPDEAALDVLGCVEHRDLARRCASDAVTLVKNGQNLLPLNTKEHQKILLTVISDPWERE
HVETLVKKQLEEAGFTVTVSNPNDSIPKDNSVRNWQKKYDLFLYISHQESARKDKLSLRI
NWHQAGNLPRFSADIPTVHISFGNPFELYDLPNIKTYINAYCLTDIVVEETLKKVLGQSD
FKGISPVDPFCGKDYLRY
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
atggtcgatttaaaagcaaaaccattttatctggatgagcgtgctgttcagtgggttgaa
acaacattgaacaatatgtctttagatgaaaaattagggcaagtttttattcagctggca
caacccgataaagattatctggatgagaaaatccttggtaagcatgttggtgggattctt
tttcgccaaaatgaagcaaaagtggtacaagaaaccttgcgctacattcaaaaatcgtca
aaaattcctgtgctattttgcggtaatttagaagaaggtggtatcggtctagctaaggaa
gggacatatttttctaagcaaatggaaaccattgctactggcaatacggactttgcttat
caaaatggtcgtgtattagctagagaagctagtgctttaggatgtcatatgtcatttggt
ccagttgtggatatgactattgactggcgttcagccattacatcaacaaatacttatgga
gccgatgccgaccaagttttgaaatatgcttctgccaatatgcaagggcaaatggataat
ggtctggtaacagcggttaagcattttccaggggaaggtgcagatgaccatgaccaacat
tacaactgtgaaatcaatgagatgtctattgccgaatgggacaatgtttttggtaaggtg
tttcaaggtttgattgaccaaggcacaatgagtatcatgccaggacatatcgctcttcca
agctatcaaaaatattatgctgatgatatgagtgggcaagtgatgccagcgacatattct
aaagcattattgaccaatcttcttagggagaaacttgggtttaatggacttattgtcagt
gataacacttgtattgctggcgcaagcaattatcttccacgctatcaagcggtaccacag
atgttaatggcaggaattgacttaattctgtatagctttgatatggatgaggatttagat
tatctaaaagcagcactccaagatggtcgtttgactatggaacgcttgaacgaagctgtg
actagaactcttgctgtcaaggcaagtttaggcttgcatgataagcaaaaggaaggaaca
ttagtgccagacgaagccgctttggatgttttgggctgtgtggaacaccgtgatttggca
agacgttgtgcaagtgatgctgtgacattagtgaaaaatgggcaaaatctcctcccccta
aacacaaaagagcatcaaaaaattttgttaaccgttatttcagatccatgggaacgtgaa
catgtcgaaactcttgttaagaagcagctagaagaagcagggtttacagtcacggtttca
aatcctaatgattctattcctaaggataatagtgtacgtaattggcagaaaaaatatgac
ttgttcctttatatttctcatcaggagtcagctcgaaaagataaattatctcttcggatt
aactggcatcaagcaggcaaccttccacgtttttctgcggatattccaaccgtacatatt
agttttggtaatccttttgaattgtatgacctaccaaatataaagacttatatcaatgct
tattgtttaacagacattgttgttgaagaaacattgaaaaaagttttaggtcagagcgat
tttaaagggattagtcctgtcgatcctttctgtggaaaagattatttacgatactaa

DBGET integrated database retrieval system