KEGG   Streptococcus gallolyticus subsp. gallolyticus ATCC BAA-2069: SGGBAA2069_c18840Help
Entry
SGGBAA2069_c18840 CDS       T01444                                 

Gene name
adh1
Definition
(RefSeq) alcohol dehydrogenase (EC:1.1.1.1)
  KO
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
sgg  Streptococcus gallolyticus subsp. gallolyticus ATCC BAA-2069
Pathway
Glycolysis / Gluconeogenesis
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sgg00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    SGGBAA2069_c18840 (adh1)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SGGBAA2069_c18840 (adh1)
  Lipid metabolism
   00071 Fatty acid degradation
    SGGBAA2069_c18840 (adh1)
  Amino acid metabolism
   00350 Tyrosine metabolism
    SGGBAA2069_c18840 (adh1)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SGGBAA2069_c18840 (adh1)
   00626 Naphthalene degradation
    SGGBAA2069_c18840 (adh1)
Enzymes [BR:sgg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SGGBAA2069_c18840 (adh1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(1940714..1941757)
Genome map
AA seq 347 aa AA seqDB search
MKSAIFEKAGLMTVEEVAKPTLQADDDVIIKVVRACVCGSDLWSYANGDEKAAHSENSGH
EALGIVEEVGSAITTVQPGDFVIVPFTHGCGECDACRAGFDGTCDNHPGYTNWSSGFQSE
YVRFHYANWALIKIPGQPSDYSEGMMKSLLTLADVMPTGYHAARVADVKRGDKVVVIGDG
AVGQCAVIAAKMRGASQIVLMSRHEDRQQMALASGATAVVAERGEEGIAKVRQILGGGAD
AALECVGTEAAIEQALGVIHNGGRVGFVGVPHYNNRPLGSTFAQNITVGGGSASVTTYDK
QLLLKAVLDGDINPGRVFTNTYRLDDINQAYKDMQDRKAIKSMIVMD
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgaaatctgctatttttgaaaaagctggtctgatgactgttgaagaagtggctaagcca
actttgcaagctgacgatgatgttattatcaaggtcgttcgtgcatgcgtctgcggttct
gacctttggtcttatgctaatggtgatgaaaaagctgcacattctgaaaactcaggtcac
gaagctctcggtattgttgaagaagttggttctgccattacgaccgtacaacctggtgat
tttgtcatcgtgccatttactcacggttgtggggaatgtgatgcttgccgtgctggtttt
gacggaacgtgtgataaccaccctggctatacaaactggtcttctggtttccaatcagaa
tatgtccgtttccactatgctaactgggctttgattaaaatccctgggcaaccgtctgat
tattcagaaggtatgatgaaatcactccttactttggctgatgttatgccaacaggttac
catgctgcgcgtgttgccgacgtaaaacgtggcgataaagtcgttgttattggtgatgga
gcggttggacaatgtgccgttattgcggcgaaaatgcgcggagcttctcagattgtcttg
atgagccgacacgaagaccgtcaacaaatggcgcttgcttcaggagctaccgctgtcgtt
gctgaacgcggtgaagaaggcattgctaaggttcgtcaaattctcggcggaggagctgac
gctgctcttgaatgtgtcggtacagaagccgctatcgagcaagctctcggtgttatccac
aatggcggacgtgttggatttgttggtgtccctcattacaataatcgtccgctaggttca
acatttgcacaaaacattactgtcggaggcggttcagcttctgtcactacctacgacaaa
caactccttcttaaagcagtccttgacggtgacatcaacccaggtcgcgtctttacaaac
acttatcgcttggacgacatcaaccaagcctacaaagacatgcaagaccgcaaagcaatc
aaatcaatgattgtcatggactaa

DBGET integrated database retrieval system