KEGG   Streptococcus gallolyticus subsp. gallolyticus ATCC BAA-2069: SGGBAA2069_c19000Help
Entry
SGGBAA2069_c19000 CDS       T01444                                 

Gene name
recD
Definition
exodeoxyribonuclease V subunit alpha (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
sgg  Streptococcus gallolyticus subsp. gallolyticus ATCC BAA-2069
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:sgg00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    SGGBAA2069_c19000 (recD)
Enzymes [BR:sgg01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     SGGBAA2069_c19000 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1954851..1957331
Genome map
AA seq 826 aa AA seqDB search
MEYFFSGTIDRIIFENASNFFKILLLEIEDTDSDFDDFEIIVTGTIADIIEGENYTFWGE
LTQHPKYGEQLRVTRYERSKPTSSGLIKYFSSDHFKGIGKKTAEKIVQLYGDNTIDKILE
DPSKLDSISGLSKENKDNFLTKLKLNYGTELILAKLAEYGLTNRVAFEIFNQYKEDSLDI
IQENPYQLVEDIQGIGFKIADQLAEQLGIEADAPQRFRAALVHSLFETSIERGDTYVEAR
DLLENAITTLEEARQIELDPAAVAKELSTLIAEDKVQNVGTKIFDNTLFYAESGIKKHLT
RILDTPLDQNFSDGDLQEEIADVEEAFGISYDDVQKNAIKEALKSKVFILTGGPGTGKTT
VINGLIAAYADLHHIDLEKKDIPIILAAPTGRAARRMNELTGLPSATIHRHLGLNGDNDY
QAIDDYLDCDLIIIDEFSMVDTWLANQLFSSISSNTQVIIVGDSDQLPSVGPGQVLADLL
KIEALPQLALTKIFRQSEDSTIVTLANQMRLGKLPADFTQKKADRSYFEASAQYIPEMIP
KIVSAAVKSGIDPQEIQILAPMYRGAAGINRLNTIIQDLLNPLKDQLSFAFGEMNFRKGD
KVLHLINDAELNVFNGDIGYITDLIPAKYTESKQDELYMSFDGTEVIYPRNEWHKITLAY
AMSIHKSQGSEFQVVILPITRQSHRLLQRNLIYTAITRSKSKLVMLGEIAAFDYAIKNEG
AKRNTYLVQRFTSSAQEEESIDLQTEISQQTSPKTDNEAEKITSPTSPQTNISKEENIQL
TLDIAENEQTQTEQEPKIYRLTEENLAFINPMIGITQADIEQFFKK
NT seq 2481 nt NT seq  +upstreamnt  +downstreamnt
atggaatacttcttttctggcacaattgaccgtattatttttgaaaatgccagtaatttc
tttaaaattttattactcgaaattgaggatactgattcagactttgatgattttgaaatc
attgttactggaacaattgctgatattatcgagggagaaaattatacgttttggggtgaa
ttaacgcaacacccaaaatatggcgaacagctcagagtcacacgttacgagcgcagcaaa
ccaacttcttctggtcttattaaatatttttcaagcgaccatttcaaaggaattggtaaa
aaaactgctgaaaaaattgtgcagctttacggcgacaataccattgataaaatcctagaa
gaccctagtaaattagacagtatttctggcctttctaaggaaaataaagacaacttttta
accaaactcaagcttaattatggtacagagctcattttagccaagctagcagagtatggc
ttgactaaccgcgttgcctttgaaatttttaatcaatacaaggaagacagtcttgatatt
atccaagaaaatccttatcaattggtcgaagacattcaagggattggttttaaaatcgct
gaccaactcgctgaacaattgggaatcgaagcagatgcccctcaacgttttcgtgccgct
ctcgtgcacagtctttttgaaacctctatcgaacgaggagatacttacgtcgaagcgcgt
gatttgcttgaaaatgccattaccacccttgaagaagctagacaaattgagttagacccc
gcagccgttgccaaagaattatcaacgcttatcgctgaagataaggtgcaaaatgtcggt
accaaaatttttgacaatactcttttttatgctgaatcaggtatcaaaaaacacctgaca
cgtatccttgatacgccactcgaccaaaacttttcagatggtgacttgcaagaagaaatc
gctgacgttgaggaagctttcggcatttcttacgatgatgtgcaaaaaaatgctatcaaa
gaagcgctcaagagcaaggtgtttattttgactggtggtcctgggacgggaaaaacgact
gttatcaacggtttgattgctgcctacgcagaccttcatcatattgaccttgaaaagaaa
gatattcctatcatcttagcagcgccaacaggacgtgctgcccgccgtatgaatgaatta
acaggcttgccaagtgcgactattcaccgccatttggggttaaatggtgataacgactac
caagctattgatgactatctcgactgtgacttgattatcattgatgaattttcaatggtt
gatacttggcttgccaatcaactctttagttccatttcgtccaatactcaagtcatcatc
gttggagatagtgaccaattgccgtctgtcggtcctgggcaagtattagctgatttatta
aaaattgaagctcttcctcaactagcattgactaaaatctttagacaatcggaagattca
accattgttacacttgctaatcagatgagacttggaaaattaccagctgacttcacacaa
aagaaagctgaccgttcttattttgaagcaagtgcacaatatatcccagaaatgattcct
aaaattgtcagcgcagctgttaagagtggcattgacccacaagaaatacaaattcttgcc
ccaatgtaccgtggcgcagctgggattaatcgacttaataccattattcaggatttactt
aacccgcttaaagatcaactctcgtttgcctttggtgagatgaatttccgtaagggtgac
aaagttctccacctcatcaacgatgctgaactcaatgttttcaatggtgatatcggctat
attacagaccttattcctgctaaatataccgaatccaaacaagacgagctttacatgtct
tttgatggcaccgaagttatctaccctcgtaatgaatggcataaaatcacccttgcttac
gccatgtcaatccacaaatcacaagggagcgaatttcaggttgtcattttgccaatcact
cgccaaagtcaccgactcttacaacgtaacctcatttacacagctatcacccgctctaag
agtaaattagtgatgttaggggaaattgccgcctttgattacgccataaaaaacgaaggc
gctaagcgcaacacctatcttgttcaacgctttacaagctccgctcaagaagaagaaagt
attgatttacaaactgaaatttctcaacaaacatcacctaaaacagataatgaagctgag
aaaatcacctctccaacttctccccaaacaaatatttctaaagaagaaaacattcaactg
acactagatattgccgaaaatgagcaaacacaaacagagcaagaaccaaaaatctatcgc
ttgacagaagaaaacttggcatttatcaacccaatgattggcattacccaagccgacatt
gaacaattttttaagaaataa

DBGET integrated database retrieval system