KEGG   Streptococcus gallolyticus subsp. gallolyticus ATCC BAA-2069: SGGBAA2069_c20800Help
Entry
SGGBAA2069_c20800 CDS       T01444                                 

Gene name
gltX
Definition
glutamyl-tRNA synthetase (EC:6.1.1.24)
Orthology
K09698  
nondiscriminating glutamyl-tRNA synthetase [EC:6.1.1.24]
Organism
sgg  Streptococcus gallolyticus subsp. gallolyticus ATCC BAA-2069
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Class
Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis [PATH:sgg00970]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2130269..2131726)
Genome map
AA seq 485 aa AA seqDB search
MPKKIRVRYAPSPTGLLHIGNARTALFNYLYARHHGGDFVIRIEDTDRKRHVEDGERSQL
ENLKWLGMDWDESPQTHEKYRQSERLDIYQKYIDQLLAEGKAYKSYVTEEELAAERERQE
AAGETPRYINEFLGMSEDEKAAYIAEREAKGIVPTVRLAVNESGIYKWHDIVKGDIEFEG
GNIGGDWVIQKKDGYPTYNFAVVIDDHLMEISHVIRGDDHIANTPKQLMVYEALGWEAPE
FGHMTLIINSETGKKLSKRDTNTLQFIEDYRKKGYMPEAVFNFIALLGWNPGGEDEIFSR
EELIKLFDENRLSKSPAAFDQKKMDWMSNEYIKNADFDTIFAMAKPFLEEAGRLTDKAEK
LVELYKPQMKSVDEIIPLTDLFFEDFPELTDAEKEFMAGETVPTVLEAFKAKLEAMSDED
FKSENIFPQIKAVQKETGIKGKNLFMPIRIAVSGEMHGPELPDTIYLLGREKSIEHIENM
LNSLK
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgcctaagaaaattcgcgtgcgttatgcaccaagtccaacaggacttttacacatcgga
aatgcgcgtactgcgctctttaattatctttatgctcgtcaccatggtggtgattttgtt
atccgtatcgaagatactgaccgtaaacgtcatgtcgaagacggggaacgttcacaattg
gaaaaccttaaatggttgggaatggattgggacgaaagcccacaaactcatgaaaaatat
cgccaatcagaacgtttggacatttaccaaaaatacattgaccaattgttggcagaaggt
aaagcttacaaatcatacgttactgaagaagaattagctgcagaacgtgaacgccaagaa
gctgctggtgaaacacctcgttatatcaacgaattccttggtatgtcagaagacgaaaaa
gctgcttatatcgcagaacgtgaagctaaaggaatcgttccaactgttcgtttggctgtt
aacgaatcaggcatttacaaatggcatgatatcgttaaaggcgacatcgaatttgaaggt
ggcaacatcggtggtgactgggttatccagaaaaaagatggttacccaacatacaacttc
gccgttgttattgatgaccatttgatggaaatttctcatgttatccgtggggatgaccat
atcgcaaacacaccaaaacaattgatggtttacgaagcacttggttgggaagcgccagaa
ttcggtcacatgacattgattatcaactctgaaactggtaaaaaattgtcaaaacgtgat
acaaatacccttcaatttatcgaagactaccgtaaaaaaggttacatgccagaagcagtc
tttaactttatcgctcttcttggttggaatcctggtggtgaagacgaaatcttctcacgt
gaagaattaatcaaactctttgatgaaaatcgtttgagcaaatctccagctgcctttgac
caaaagaaaatggactggatgagcaacgaatacatcaagaatgctgattttgatacaatc
tttgcaatggcaaaaccattcttggaagaagctggtcgtttgactgacaaagctgaaaaa
ttggttgaactttataaaccacaaatgaaatctgttgacgaaatcattccattgactgac
ttgttcttcgaagatttcccagaattgacagatgctgaaaaagaattcatggctggtgaa
accgttccaacagttcttgaagctttcaaagctaaacttgaagcgatgagtgacgaagat
ttcaaatcagaaaatatcttcccacaaatcaaagctgttcaaaaagaaactggtatcaaa
ggtaaaaacctctttatgccaattcgtatcgctgtttcaggtgaaatgcacggtccagaa
cttccagatactatctaccttcttggtcgtgaaaaatcaattgaacacatcgaaaatatg
cttaacagcttgaaataa

DBGET integrated database retrieval system