KEGG   Streptococcus gallolyticus subsp. gallolyticus ATCC BAA-2069: SGGBAA2069_c20890Help
Entry
SGGBAA2069_c20890 CDS       T01444                                 

Gene name
galU
Definition
UTP--glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
sgg  Streptococcus gallolyticus subsp. gallolyticus ATCC BAA-2069
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sgg00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SGGBAA2069_c20890 (galU)
   00052 Galactose metabolism
    SGGBAA2069_c20890 (galU)
   00500 Starch and sucrose metabolism
    SGGBAA2069_c20890 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    SGGBAA2069_c20890 (galU)
Enzymes [BR:sgg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     SGGBAA2069_c20890 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2139724..2140638
Genome map
AA seq 304 aa AA seqDB search
MRKVRKAVIPAAGLGTRFLPATKALAKEMLPIVDKPTIQFIVEEALKSGIEDILVVTGKS
KRSIEDHFDSNFELEYNLEHKGKTDLLKLVNDTTAINLHFIRQSHPRGLGDAVLQAKAFV
GNEPFVVMLGDDLMDINNDKAVPLTKQLINDYETTHASTIAVMPVPHEEVSSYGVIAPQG
EGIDGLYSVETFVEKPAPEDAPSDLAIIGRYLLTPEIFNILETQEPGAGNEIQLTDAIDT
LNKTQRVFARQFNGDRYDVGDKFGFMKTSIDYALQHPQIKDSMKQYLIDLGKELEADSKK
EETK
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaagttagaaaagccgtcattcccgctgctggtcttggaacacgcttcttgcca
gcaactaaagcactcgctaaagagatgcttccaattgttgataaaccaaccattcaattt
atcgtcgaagaagccttgaaatcaggtatcgaagacattttggttgttactgggaaatca
aaacgttcaatcgaagaccacttcgattcaaattttgaattagaatacaatttggaacat
aaagggaaaactgaccttctcaaacttgtgaatgatacaacagctatcaatcttcacttt
atccgtcaaagccatccacgcggattgggagacgctgttctgcaagccaaagcctttgtt
ggtaacgaacctttcgttgttatgcttggtgatgaccttatggatatcaataacgataaa
gctgtaccattgacaaaacaactgatcaatgactacgaaaccacacacgcatcaactatc
gccgttatgcccgtaccacacgaagaagtatcatcttacggtgttattgctcctcaaggc
gaaggcattgacggactttatagcgttgaaacatttgttgaaaaaccagcccctgaagat
gcaccaagtgaccttgcaatcatcggtcgttatcttcttactccagaaatcttcaatatc
cttgaaacacaagaacctggagctggtaatgaaattcaattgacagacgctatcgatacc
cttaacaaaacacaacgtgtttttgcgcgccaatttaacggtgaccgctatgatgtcggt
gacaaatttggttttatgaaaacttctattgactatgcccttcaacaccctcaaatcaaa
gatagcatgaaacaatatcttatcgatttaggtaaagaattagaagctgattcaaaaaaa
gaagaaactaaataa

DBGET integrated database retrieval system