KEGG   Streptococcus gallolyticus subsp. gallolyticus ATCC BAA-2069: SGGBAA2069_c20890Help
Entry
SGGBAA2069_c20890 CDS       T01444                                 

Gene name
galU
Definition
(GenBank) UTP--glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
sgg  Streptococcus gallolyticus subsp. gallolyticus ATCC BAA-2069
Pathway
sgg00040  Pentose and glucuronate interconversions
sgg00052  Galactose metabolism
sgg00500  Starch and sucrose metabolism
sgg00520  Amino sugar and nucleotide sugar metabolism
sgg01100  Metabolic pathways
sgg01130  Biosynthesis of antibiotics
Module
sgg_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sgg00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SGGBAA2069_c20890 (galU)
   00052 Galactose metabolism
    SGGBAA2069_c20890 (galU)
   00500 Starch and sucrose metabolism
    SGGBAA2069_c20890 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    SGGBAA2069_c20890 (galU)
Enzymes [BR:sgg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     SGGBAA2069_c20890 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD
Motif
Other DBs
NCBI-ProteinID: CBZ49261
Position
2139724..2140638
Genome map
AA seq 304 aa AA seqDB search
MRKVRKAVIPAAGLGTRFLPATKALAKEMLPIVDKPTIQFIVEEALKSGIEDILVVTGKS
KRSIEDHFDSNFELEYNLEHKGKTDLLKLVNDTTAINLHFIRQSHPRGLGDAVLQAKAFV
GNEPFVVMLGDDLMDINNDKAVPLTKQLINDYETTHASTIAVMPVPHEEVSSYGVIAPQG
EGIDGLYSVETFVEKPAPEDAPSDLAIIGRYLLTPEIFNILETQEPGAGNEIQLTDAIDT
LNKTQRVFARQFNGDRYDVGDKFGFMKTSIDYALQHPQIKDSMKQYLIDLGKELEADSKK
EETK
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaagttagaaaagccgtcattcccgctgctggtcttggaacacgcttcttgcca
gcaactaaagcactcgctaaagagatgcttccaattgttgataaaccaaccattcaattt
atcgtcgaagaagccttgaaatcaggtatcgaagacattttggttgttactgggaaatca
aaacgttcaatcgaagaccacttcgattcaaattttgaattagaatacaatttggaacat
aaagggaaaactgaccttctcaaacttgtgaatgatacaacagctatcaatcttcacttt
atccgtcaaagccatccacgcggattgggagacgctgttctgcaagccaaagcctttgtt
ggtaacgaacctttcgttgttatgcttggtgatgaccttatggatatcaataacgataaa
gctgtaccattgacaaaacaactgatcaatgactacgaaaccacacacgcatcaactatc
gccgttatgcccgtaccacacgaagaagtatcatcttacggtgttattgctcctcaaggc
gaaggcattgacggactttatagcgttgaaacatttgttgaaaaaccagcccctgaagat
gcaccaagtgaccttgcaatcatcggtcgttatcttcttactccagaaatcttcaatatc
cttgaaacacaagaacctggagctggtaatgaaattcaattgacagacgctatcgatacc
cttaacaaaacacaacgtgtttttgcgcgccaatttaacggtgaccgctatgatgtcggt
gacaaatttggttttatgaaaacttctattgactatgcccttcaacaccctcaaatcaaa
gatagcatgaaacaatatcttatcgatttaggtaaagaattagaagctgattcaaaaaaa
gaagaaactaaataa

DBGET integrated database retrieval system