KEGG   Sinocyclocheilus grahami: 107557412Help
Entry
107557412         CDS       T04918                                 

Definition
(RefSeq) monoacylglycerol lipase ABHD6-like
  KO
K13700  
abhydrolase domain-containing protein 6 [EC:3.1.1.23]
Organism
sgh  Sinocyclocheilus grahami
Brite
Enzymes [BR:sgh01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     107557412
Peptidases [BR:sgh01002]
 Serine Peptidases
  Family S33
   107557412
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
Unknown
AA seq 318 aa AA seqDB search
MDLDVVNMFIIAGGTLAIPILAFVASFLLWPAALIKVYHWYWRRRLGMQVDYAEYEGYRF
CYSHRGTPGTRPSVLLLHGFSAHKDMWLGVVKFLPKNMHLVCVDMPGHEGTTRSSAVDYS
IEGQVKRIHQVGIFWGGNYIYIYSLTDISSQTFLALAGLQYPTESKFVQRLRELEKAQDS
DGIPLIPSTPEEMEEMLKLCSYVRFKIPKQILQGLVDVRLPNNDFYRECFMELVGEKSRH
SLHENMHLISTPLQVIWGKNDQVLDVSGASVLARAIPGSQVHLLDNCGHSVVMERPRKSA
QLIMDFIISQQNSNKKLS
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atggatttggacgtggtgaacatgttcatcattgccggcgggacgctggcgatccccatc
ctggcttttgtagcctccttcctgctctggcctgcagctctcattaaagtttatcactgg
tattggcgcagaaggctgggaatgcaggtggattatgctgaatatgaaggatatcgcttc
tgttactctcacagagggactccaggcacccgtccgtccgtcctcttgttacacggcttc
tctgcacacaaagacatgtggctcggtgtggtcaagtttcttcctaaaaatatgcacctg
gtgtgtgttgacatgccgggacatgagggtacgacccgcagcagtgctgtggattactcc
atcgagggccaagtcaaacggatacatcaggtgggtattttctgggggggaaattatata
tatatatattctctaacagacatttcttctcaaacatttctcgctctggcaggtctccag
tatcccactgaaagtaagtttgttcagcgtttgagggaactggagaaagctcaggacagt
gacgggatcccgctgataccctccacaccagaagagatggaggagatgctcaaactgtgt
tcctatgtacgctttaagatccctaaacagattcttcaaggactggttgacgtccgtctt
cctaacaatgacttctaccgcgagtgtttcatggagcttgtcggagagaaatccagacac
tctttacatgagaacatgcatctcatttcaactcctctacaagttatttgggggaaaaac
gaccaggtgttagacgtgtctggggcttcagttctggccagagccatcccaggatctcag
gttcatctgctagacaactgtggtcattcagtagtgatggagcggccgaggaaatccgcc
cagctcatcatggactttatcatctcacaacagaacagcaacaagaaactgtcctaa

DBGET integrated database retrieval system