KEGG   Sodalis glossinidius: SG0273Help
Entry
SG0273            CDS       T00316                                 

Definition
dioxygenase
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
sgl  Sodalis glossinidius
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:sgl00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
493432..493977
Genome map
AA seq 181 aa AA seqDB search
MRALTIYSDTDATAPRWQSHEGDAIQRELNAIGVRFERWQTDRELGANPDADTVIAAYQD
AIDRLVAEKGYQSWDVISMRPDNPQRETLRTKFLAEHTHGEDEVRFLVEGAGLFCLHVQG
KIYQILCEKNDLISVPAGTAHWFDMGEAPSFTAIRVFDNPEGWIARFTGDAIADEYPRLV
R
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgagagcactgaccatttattctgatactgatgccacggcaccgcgttggcaaagccac
gagggtgacgccatccagcgtgagctgaacgctatcggcgtgcgtttcgagcgctggcag
accgatcgcgaactgggggcgaaccccgacgccgatacggttatcgctgcctatcaagat
gcgatcgatcgcctggtggcggaaaagggctatcaaagctgggatgtcattagcatgcgc
ccggataatccccagcgcgagaccctgcgcaccaaatttctggcggagcatacccatggc
gaggatgaagtacggtttttagtcgagggcgccggtctgttttgcctgcatgtacaggga
aaaatctatcaaatactgtgcgaaaaaaatgatttaatctcggtaccggccggcacggcg
cactggtttgatatgggcgaagcgcccagctttaccgctatccgggtgtttgacaacccg
gaggggtggattgcccgttttaccggagatgctattgctgatgagtatccgcgtttggtg
cgttaa

DBGET integrated database retrieval system