KEGG   Sodalis glossinidius (Glossina spp.): SG0350Help
Entry
SG0350            CDS       T00316                                 

Definition
adenosine-3'(2'),5'-bisphosphate nucleotidase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
sgl  Sodalis glossinidius (Glossina spp.)
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sgl00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    SG0350
Enzymes [BR:sgl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     SG0350
Transfer RNA biogenesis [BR:sgl03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    SG0350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
638002..638748
Genome map
AA seq 248 aa AA seqDB search
MIEHIIALSREAGAAIMQVYNGDKPLELDQKQDDSPVTTADLAAHRVIAAGLHALAPDTP
LLSEEDPPDWSLRQHWRRFWLVDPLDGTKEFLRRNGEFTVNITLIEEGKPVIGVVYAPVT
DRLYAAANGKAWRIDENGKQQTIEVKEARPPLVVVSRSHGNNAELQDYLAHLGEHQTVTI
GSSLKFCLVAEGTAQLYPRFVPTNVWDTAAGHAVAVAAGAQVNDWQGRPLDYTPRESFLN
PGFRVSLF
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgattgaacacatcatcgcgctttcccgcgaggcaggcgcggctattatgcaggtctac
aacggcgacaaaccgctggagctggatcagaagcaagatgactcgccggtgaccaccgcc
gatctggccgcgcatcgggtcattgccgccggattgcatgcgctggcgccggatactccc
ctcctttctgaagaagatccgccggactggtcccttcgtcagcactggcgccgtttctgg
ctggtagatcccctggacggcaccaaagagttcctgcgtcgtaacggcgaattcaccgtc
aatatcacgttaattgaggaaggtaagcccgtgataggcgtggtctatgcccctgtgacc
gataggctttatgccgccgcgaatggcaaagcctggcgaatcgacgagaatggcaaacaa
cagacgatcgaagttaaagaggcgcgtccgccgctggtagtggtgagccgttctcatggc
aacaatgcggagctgcaggattatctggcccatctgggtgagcaccaaacggtgacgatt
ggttcctcgctgaagttttgtctggtggcggagggcacagcacagctttatccccgtttc
gtgccgaccaacgtctgggacaccgccgcaggacacgcggtggcggtggcggccggcgcc
caggtcaatgattggcagggacggccgctggattacaccccgcgcgagtctttcctcaat
cccggcttcagggtgtcgctgttctga

DBGET integrated database retrieval system