KEGG   Sodalis glossinidius (Glossina spp.): SG0372Help
Entry
SG0372            CDS       T00316                                 

Gene name
folP
Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
sgl  Sodalis glossinidius (Glossina spp.)
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sgl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SG0372 (folP)
Enzymes [BR:sgl01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     SG0372 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
668550..669395
Genome map
AA seq 281 aa AA seqDB search
MQLIARERTLSLAVPRVMGILNVTPDSFSDGGKFQRLADAIDHAAAMLAAGAALIDIGGE
STRPGAQAVSDEEEAARVVPVVAALAERFDTFISVDTSKALVMRESAAAGAHLINDIRAL
SEPGSLDAAAASQLPVCLMHMQGEPGTMQQAPHYENVLAEVEAFLTQQIARCEAAGITKN
RLLLDPGFGFGKTLAHNYRLLARLGDLHHLGLPLLVGMSRKLMIGELLDLPAEQRVTGSV
ACAVIAALQGAQIIRVHDVRHTVEAMRVVEATLIAKETYFQ
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgcaacttattgcgcgagagcgcacccttagcctggcggtgccccgcgtcatggggatc
ctcaacgtaactccggactcgttctctgacggcggcaaatttcagcgtctggccgacgcc
attgatcatgccgcggcgatgctggcggccggtgcagccctcatcgatattggtggagaa
tccacccgcccgggggcgcaggcggtcagcgatgaagaggaagcggcgcgggtggtgccg
gtagtggcggcgctggcggaacgttttgatacttttatttccgtggatacctccaaggcg
ctggtgatgcgtgaaagcgcggcggccggggctcatttgatcaacgatatccgcgcgctc
agtgaaccgggttccctggacgccgctgccgccagccagctgcccgtctgtctgatgcat
atgcagggcgagccgggtaccatgcagcaggcgccgcattatgagaatgtgctggcagag
gtagaggcttttctcacacagcaaattgcgcgctgtgaagctgccggcatcaccaaaaac
cgactgttgcttgatccgggcttcggtttcggcaagaccctggcgcataattatcgcctc
ctggcccggttgggtgatttgcatcatctcgggctgccgctgttggtggggatgtcgcgt
aaattaatgataggcgaattgttggatcttccggcagaacagcgggttacaggcagcgtc
gcctgcgcggttatcgccgcgctgcagggggcgcagatcatccgggtccatgacgtcagg
cacaccgtggaagcaatgcgcgtggtggaagccacgcttatagcgaaggaaacctatttt
caatga

DBGET integrated database retrieval system