KEGG   Sodalis glossinidius: SG0390Help
Entry
SG0390            CDS       T00316                                 

Definition
DNA polymerase III subunit psi
Orthology
K02344  
DNA polymerase III subunit psi [EC:2.7.7.7]
Organism
sgl  Sodalis glossinidius
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:sgl00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    SG0390
   00240 Pyrimidine metabolism
    SG0390
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    SG0390
   03430 Mismatch repair
    SG0390
   03440 Homologous recombination
    SG0390
Enzymes [BR:sgl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     SG0390
DNA replication proteins [BR:sgl03032]
 Prokaryotic Type
  DNA Replication Elongation factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     SG0390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
692248..692661
Genome map
AA seq 137 aa AA seqDB search
MTTRRDWQLQQLGITQWTLRRPAVLQGEVAVKLPDQIRLLLVADPLPPVDHPLVVDVARS
MALTPAQLYGVTPEQVVMLPDSVRCHCWWLGLEATRDFAGISFHTPPLAALSQDAGAKRE
LWHRISDNEHGITAAAG
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
atgacgacaaggcgcgactggcaattacaacagctcggcattacgcaatggacgctccgg
cgcccggcggtattgcagggtgaggttgcggtcaaattgccggatcagattcgtttgttg
ctggtggccgacccgctgccgccggtggatcatcccttggtggtcgatgtggcccgcagc
atggcgctgacgccggcgcagctttatggggtgacgccggagcaggtggtgatgttgcct
gacagcgtgcgctgccattgctggtggcttgggctggaagccacgcgcgattttgccggc
atatctttccacacgccgccgctagcggcgctttcacaggacgctggcgcgaaacgcgag
ctatggcaccggataagtgataatgaacacggtattaccgctgctgccggctga

DBGET integrated database retrieval system