KEGG   Sodalis glossinidius (Glossina spp.): SG0395Help
Entry
SG0395            CDS       T00316                                 

Gene name
deoA
Definition
thymidine phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
sgl  Sodalis glossinidius (Glossina spp.)
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sgl00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    SG0395 (deoA)
Enzymes [BR:sgl01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     SG0395 (deoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
698805..700136
Genome map
AA seq 443 aa AA seqDB search
MFLAQEIIRKKRDGEPLSDEEIRFFINGVYDNTVSEGQIAALAMTIFFHDMDLQERVALT
LAMRDSGHTLDWRREALGGPVVDKHSTGGVGDVTSLMLGPMIAACGGFVPMVSGRGLGHT
GGTLDKLEAIPGLAIFLDDDAFRSQVKQVGVAIMGQTHSLAPADKRIYATRDITATVDSI
PLITASILAKKLAEGLDALVMDVKVGSGALMPTLAGSEALAQAIVGVANGAGCRTIALLT
DMNQVLASSAGNALEVREAVRFLTNDERNPRLFEVTMALCSEMLMIAGLAHSEDAARTAL
VRALDSGEAAERFGRMVAVQGGPADFVQRYDLYLPVATLSKPVFPAGEGYIRSMDTRALG
MTVVALGGGRQRARDAIDYSVGLTEMARLGDYVDANTPLAVVHAASEESWARAAEAVRAA
IQLGDVAPQALPVVYRRITAAAD
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
gtgtttctggcacaagaaattatccgtaaaaagcgggatggcgagccgctgagcgacgaa
gagattcgctttttcatcaatggggtatacgataacaccgtctcggagggccaaatcgca
gcgctggcgatgaccatctttttccacgatatggatttgcaggaacgtgtggcgttgacg
ctggcgatgcgcgactccggccatactctggactggcgccgtgaggcattgggcgggccg
gtggtggataagcattctaccggcggcgtgggcgatgtcacctcgctgatgctcgggccg
atgatcgccgcctgcggcggtttcgtacctatggtctccgggcgcggactcgggcatacc
ggcggcacgctcgataaactggaggccattccggggctggcgatttttctggacgacgat
gccttccgctcccaggtaaaacaggtcggggtggcgattatggggcagacccactcgctg
gcgccggcggacaagcgcatttatgctacccgcgatattaccgcgacggtggattcgatc
ccgcttatcaccgcctcgattctggcgaaaaagctggcggaagggctggatgcgctagtg
atggacgtcaaggtaggctccggcgccctgatgcccacccttgcgggctcggaagcgctg
gcgcaggctattgtcggcgttgccaacggcgcgggctgcaggacgatcgcgttgctgacc
gatatgaatcaggtcctggcctccagcgccggcaacgccctggaagtgcgcgaagcggtc
cggtttctgaccaacgacgaacgcaacccgcggctgttcgaggtcaccatggcgctgtgc
agcgaaatgctgatgatcgccggcctggcgcacagtgaggacgcggcgcgcacggcgctg
gtgcgggcgctggacagcggcgaggcggcggaacgtttcggccggatggtggcggtgcag
ggtggcccggcggattttgtccagcgttatgatctttacctgccggtggcgacgctcagc
aaaccggtctttccggccggagaggggtatattcgcagcatggatacccgcgcgctgggt
atgaccgttgtggcgttgggcggcggccgtcagagggccagagacgccattgattatagc
gttggtctcaccgagatggcgcggttgggagactatgtcgacgccaacacgccgctggcc
gtagtccatgccgccagcgaggaaagctgggcgcgcgcggccgaggcggtacgcgcggcc
atccaactgggggacgtggcgccacaagcgttaccggtggtttatcgccgtatcaccgcg
gcggccgattaa

DBGET integrated database retrieval system