KEGG   Sodalis glossinidius (Glossina spp.): SG0406Help
Entry
SG0406            CDS       T00316                                 

Definition
(GenBank) threonine synthase ThrC
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
sgl  Sodalis glossinidius (Glossina spp.)
Pathway
sgl00260  Glycine, serine and threonine metabolism
sgl00750  Vitamin B6 metabolism
sgl01100  Metabolic pathways
sgl01110  Biosynthesis of secondary metabolites
sgl01120  Microbial metabolism in diverse environments
sgl01230  Biosynthesis of amino acids
Module
sgl_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:sgl00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SG0406
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    SG0406
Enzymes [BR:sgl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     SG0406
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Thr_synth_N
Motif
Other DBs
NCBI-ProteinID: BAE73681
UniProt: Q2NVZ4
Position
719114..720403
Genome map
AA seq 429 aa AA seqDB search
MKLYNIKEHNEQVSFAQAIKQGLGRQQGLFFPMALPEFALTEIDELLEMDFVARSARILS
AYIGDELPPERVLARVAAAFEFPAPVVPVSKDIAALELFHGPTLAFKDFGGRFMAQMLTE
VGKGQQVTILTATSGDTGAAVVHAFYGLENVRVVILYPEGKISPLQEKLFCTLGGNIHTV
AVEGDFDACQALVKQAFDDEELKQTLGLNSANSINISRLLAQICYYFEAVAQLPQKARNQ
LVVSVPSGNFGDLTAGLLAKTLGLPVKRFIAATNANDTVPRFLRDGKWLPNPTVATLSNA
MDVSQPNNWPRVKELFRRKNWQLTTLDYGCVDDNTTAETMRELAGLGYISEPHAAIAYRL
LRDSLQPGEYGLFLGTAHPAKFKESVDTILGQSLPLPPALAVRATLPLLSERMPASFSAL
RTLMLGLAP
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgaaactctacaatatcaaggaacacaacgagcaggtcagcttcgcccaggcgatcaag
cagggcctcggccgtcagcaggggctgttttttcccatggcgctgcccgaattcgccctg
accgagatagacgagttgctggaaatggatttcgtcgcacgcagcgcgcgcatcctgtcg
gcctatatcggtgatgagctgccgccggagcgcgttctggcgcgggtggcggcggcgttt
gagttcccggcgccggtggtaccggtctccaaggatatcgccgcgctggagctgtttcat
ggcccgaccctggcattcaaggattttggcggccgttttatggcgcagatgctcaccgag
gttggcaaagggcagcaggtcaccatcctgaccgcgacctccggtgataccggcgctgcg
gtggtgcatgcgttttacggcctggagaatgtgcgggtcgtgatcctttaccccgagggc
aaaatcagtccgctgcaggaaaaactcttttgtacgctgggcggcaatattcacactgtg
gcggtcgagggcgatttcgacgcctgccaggcgctggtgaaacaggcgttcgatgatgaa
gaattgaaacagacgctagggctgaactccgccaactctatcaatatcagtcgtctgctg
gcgcagatttgctattactttgaagcggtggcgcaactgccgcagaaagcgcgtaatcaa
ctggtggtgtcggtaccgagcggcaacttcggcgatctcaccgccggtctgctggccaaa
accctggggctgccggtgaagcgttttatcgccgccaccaacgccaacgataccgtaccg
cggtttttacgcgacggtaaatggctgcctaatccgaccgtggccacgctgtcaaacgcg
atggacgtcagccagcccaataattggccgcgggtgaaagaattgttccggcgcaaaaac
tggcaactgaccacgctcgattacggctgcgtcgacgataacaccaccgccgagacgatg
cgcgagctggcgggattgggctatatttccgagccgcatgccgccatcgcctaccgcctg
ttgcgcgacagtttacagcctggggagtacggattattcctcggcaccgcccatccggcc
aagttcaaggaatcggtggacacgatcctcggccaaagtctgccgttgccgccagcgctg
gcggtgcgcgcgacgttgccgttgttgtcggagcgcatgccggcgtctttcagcgccctg
cgcacgctgatgttggggctggcgccctaa

DBGET integrated database retrieval system