KEGG   Sodalis glossinidius: SG0468Help
Entry
SG0468            CDS       T00316                                 

Definition
pyruvate dehydrogenase dihydrolipoyltransacetylase component
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
sgl  Sodalis glossinidius
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:sgl01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:sgl00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:sgl00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:sgl00620]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
808139..809719
Genome map
AA seq 526 aa AA seqDB search
MAIEINVPDIGADEVEVTEVLVSVGDKVDAEQSLITVEGDKASMEVPSPQAGVVKELKVA
VGDKVTTGKLIMVFEEAEGGAEKPAAAPEKADSAAAKPAAGGGAAQSKEVNVPDIGGDEV
EVTEVLVKVGDKVEAEQSLITVEGDKASMEVPAPFEGIVKEIKINVGDKVSTGSQIMMFE
VEGAAKESAAAVAPASASDANKSAAAAPSSSEGKGEFAENDAYVHATPVIRRLAREFGVN
LAKVKGTGRKGRILREDIQAYVKEAVKRAEAAPAAAGTLPGLLPWPKVDFSKFGDTEEVE
LGRIQKISGANLHRNWVMIPHVTQFDEADITEVEAFRKQQNAEAEKKKLDVKITPLVFIM
KAVAKALEELPHFNSSLSADAQKLTLKKYINIGVAVDTPNGLVVPVFRNVNKKGIVELSR
ELAEISKKARAGKLTSSDMQGGCFTISSLGGIGGTAFTPIVNAPEVAILGVSKSSTKPVW
NGKEFAPRLMLPLSLSYDHRVIDGADGARFISFINNVMSDIRRLVM
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atggctattgaaatcaacgtaccggatatcggtgcagatgaagtggaagtcaccgaagtc
ctggtcagcgtgggcgataaagttgacgccgagcagtcgctgattaccgtggaaggcgat
aaagcgtccatggaagtgccctcgccgcaggcgggggtggtgaaagagttaaaggtggcg
gtgggcgataaagtcaccaccggcaaactgattatggtcttcgaggaagccgagggtggc
gctgagaagcctgccgcagcgccggagaaggccgacagcgcggcggccaaaccggccgcc
ggcggcggtgccgcacagagtaaagaggttaacgttcccgatatcggcggcgacgaggtg
gaagtcaccgaagtgctggtgaaggtgggtgacaaggtcgaagccgaacagtcgcttatc
accgtcgagggcgacaaggcgtcgatggaagtgccggcgccgttcgagggtatcgtcaaa
gagatcaagattaacgttggtgataaagtcagcacaggttcgcagattatgatgttcgag
gtggaaggagccgccaaggaaagcgccgcggctgtggcccctgcgtcggcatcagacgcc
aacaaaagcgcagctgctgccccgtcatcgtccgaaggcaaaggtgaatttgccgagaat
gatgcctatgtgcacgctaccccggtgattcgccgtctggcgcgcgagttcggcgtcaac
ctggcgaaagtgaaaggcaccgggcgcaaaggccgtatcctgcgtgaagatattcaggca
tacgtcaaagaggctgtcaaacgcgctgaggccgccccagccgctgccggtacgctgccg
gggctgctgccgtggccgaaggtggacttcagcaagttcggcgacaccgaagaggtggag
ctgggccggattcagaaaatctccggcgccaacctgcaccgtaactgggtcatgatcccc
catgtaacccagttcgacgaagccgatatcaccgaagtggaagccttccgcaaacagcag
aacgctgaagccgagaagaagaagctggatgtgaaaatcaccccactggtgtttatcatg
aaagcggtcgccaaggcgctggaagagctgccgcattttaacagctcgctgtcggcggac
gcccagaaactgacgctgaagaaatacatcaatatcggcgtggcggttgataccccgaac
ggcctggtcgtgccggtgttccgcaatgtgaataagaaaggcatcgtagagctgtcgcgc
gagctggcggagatctcgaaaaaggcccgcgccggcaaactgacttcgtcggatatgcag
ggcggctgcttcaccatctccagcctgggcggcattggcggcacggcgttcacgcctatc
gtcaatgcgccggaagtggcgattctcggtgtatcaaaatcgtcgacgaaaccggtatgg
aatggtaaagagtttgcgccgcggctgatgttgccgctgtcgctgtcctatgaccaccgg
gtcatcgacggcgccgacggtgcgcgattcatcagcttcatcaataacgttatgtctgat
attcgccgcttggtgatgtaa

DBGET integrated database retrieval system