KEGG   Sodalis glossinidius: SG0600Help
Entry
SG0600            CDS       T00316                                 

Definition
gamma-glutamyl kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
sgl  Sodalis glossinidius (Glossina spp.)
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:sgl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SG0600
  Amino acid metabolism
   00330 Arginine and proline metabolism
    SG0600
Enzymes [BR:sgl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     SG0600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1011401..1012504
Genome map
AA seq 367 aa AA seqDB search
MNSSQTLVIKLGTSVLTGGSRRLNRAHIVELVRQCAPLHAAGHRIIIVTSGAIAAGREYL
NYPELPATIASKQLLAAVGQSRLIQFWEQLFSLYNIHIGQMLLTRADMEDRERFLNARDT
LRALLDNGIVPVINENDAVATAEIKVGDNDNLSALVAILADADKLLLLTDQPGLFSADPR
TNPDAELIREVEGINDALRKMAGGSVSGLGTGGMETKLQAAEVANRAGIEVVIAAGGKPG
VIGDMMAGASVGTRFHGQKMPLESRKRWLFGPPPAGDITVDDGALKAILQRGSSLLPKGI
LAVEGDFSRGIVVRIRSTDGRDIAHGVSRYNSDALRMIAGHHSQDISDILGYEYGPVVIH
RDDMILC
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgaacagcagccagactctggtgattaaattaggcaccagcgtccttaccggtggttcg
cgccggctcaaccgggcccatattgtcgagctggtgcgccagtgtgctccgctgcatgcc
gccgggcaccggattattatcgttacctccggcgccattgccgccggacgggaatacctc
aattatcccgagctgcccgccaccatcgcctcaaaacagctgttggcggcggtggggcag
agccgcttgattcagttttgggaacagttgttttccctttacaacattcatatcggccaa
atgttgctgacccgagccgatatggaagatcgcgaacggttccttaatgcccgcgatacg
ctgcgcgccttattggataacggtatcgtgccggtcatcaatgaaaatgacgcggtcgcg
accgccgaaatcaaagtgggcgacaacgataatctgtcggcgctggtggcgattttggcc
gatgccgacaagctgctgctgctaaccgatcagccaggcctgttctccgccgatccgcgc
actaaccctgacgcggagctcatacgcgaggtcgaaggtatcaacgatgcgttgcgcaaa
atggccggcggcagcgtctccggcctcggtaccggcggcatggagacgaaactgcaagcg
gccgaagtcgccaaccgcgccggaatcgaagtcgtgattgcggccggtggcaaaccaggt
gtgattggcgatatgatggccggtgcatcggtaggcacccgtttccacggccagaaaatg
ccgctggagagccgcaaacgctggctgttcggcccgccgccggcgggggacattaccgtc
gacgatggcgcgctgaaggcaatattacaacgcggcagctcgctgttgcccaaaggcatt
ctggcggtggaaggcgacttttcccgcgggattgtcgtgcgtattcgcagcaccgatggc
cgcgatattgcccacggtgtcagccgctacaacagcgatgccctacgcatgattgccggt
caccattcacaggacatcagtgatattctggggtatgaatacgggcctgtggttatccac
cgcgacgacatgattttatgttaa

DBGET integrated database retrieval system