KEGG   Sodalis glossinidius: SG0691Help
Entry
SG0691            CDS       T00316                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
sgl  Sodalis glossinidius
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:sgl03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1165670..1166275
Genome map
AA seq 201 aa AA seqDB search
MQTSPLLEALTEALRCLPGVGPKSAQRMVFHLLQRDRSGGMRLAQALTRAMSEIGHCADC
RTFTEQPVCTICANPRRQQSGQICVVESPADIHAIEQTGQFAGSYFVLMGHLSPLDGIGP
DDIGLGRLQERLENESIEEVILATNPTVEGEATANYIAEMCAHYGVMASRIAHGVPVGGE
LEMVDGTTLSHSLAGRHPIKF
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaccagtcccttactggaggcattgacggaggccttgcgctgcctgccgggcgtc
gggccgaaatcggcgcagcgtatggttttccatttactgcagcgcgatcgcagcggcggg
atgcgtctggcgcaggcgctgacccgcgcgatgtcggaaatcggccattgtgcggattgc
cgcaccttcaccgagcagcctgtctgcacgatttgcgccaatccccgccggcagcagtcg
ggccaaatctgcgtggtggaaagcccagcagacatccatgctattgagcagaccggccag
ttcgccgggagctattttgtgctgatggggcacctgtcacctctcgatggtatcggcccg
gacgatatcggtctcgggcggctgcaggagcggcttgagaacgaaagcattgaagaggtc
atcctggccaccaacccgacggtagaaggggaggcgaccgccaactatatcgctgaaatg
tgcgcgcattacggtgtcatggctagccgcatcgcccatggcgtgccggtaggcggcgag
cttgaaatggtggacggcaccacgctgtcccattcgctggcgggccgtcatcccatcaag
ttctga

DBGET integrated database retrieval system