KEGG   Sodalis glossinidius: SG0728Help
Entry
SG0728            CDS       T00316                                 

Definition
phage lysozyme lysis protein
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
sgl  Sodalis glossinidius
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1215147..1215644)
Genome map
AA seq 165 aa AA seqDB search
MSPELRKRLITVTSGGVLALAAVLVQWHEGKRYKPYRDGGGVLTVCHGHTGKDVTPGEIY
NEEECNALMKKDLQVARATVERYVTVQLTDLQKAALTSFVYNIGSGAFANSTLLKKLNAG
DIQGACDQMRRWKYDEGKVSNGLINRREVEREICLNPNALINPTQ
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgtctcccgaacttcgtaaacgattgataacagtgacgtcaggtggcgtattagcgctg
gctgccgtcttggtgcagtggcacgaaggtaagcgctataagccctatcgtgatggcggc
ggggtgctcactgtctgtcacggtcataccggcaaggacgttacgccaggggaaatttat
aacgaagaagaatgtaacgcgttgatgaaaaaggatttgcaggtagcacgtgctactgtt
gaacgttatgtcactgttcagcttaccgatttgcagaaagccgctttgacttcatttgtt
tacaatatcggcagtggggcatttgccaattcaacgctacttaaaaagttgaacgccgga
gatattcaaggcgcttgtgaccagatgcgccgatggaaatacgatgaaggaaaggtatca
aacgggctgattaaccgcagagaggtagaacgggaaatttgtttaaatccgaatgcacta
atcaatccaactcaatga

DBGET integrated database retrieval system