KEGG   Sodalis glossinidius: SG0873Help
Entry
SG0873            CDS       T00316                                 

Gene name
sdhD
Definition
succinate dehydrogenase cytochrome b556 small membrane subunit (EC:1.3.5.1)
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
sgl  Sodalis glossinidius
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Succinate dehydrogenase, prokaryotes
Class
Metabolism; Overview; Carbon metabolism [PATH:sgl01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:sgl00020]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:sgl00650]
Metabolism; Energy metabolism; Oxidative phosphorylation [PATH:sgl00190]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1428928..1429275
Genome map
AA seq 115 aa AA seqDB search
MISNASALGRNGVHEWLLVRASAIVICLYIIYLLGFILLADTLTYDVWRGFFATPMTKVF
TLLTLFSILVHTWIGMWQVLTDYIKPLALRLLLQLTIVIVLMVYLLYGTVVVWGA
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atgataagcaatgcttcggcattaggacgtaacggagtacatgagtggctattggttcgt
gcatctgccatcgttatttgcctttatattatttatctgctcggttttatcctgttggca
gatactctcacctatgacgtctggcgaggttttttcgccacccctatgacgaaagtcttt
accctgctgaccttgttttccatcctggtgcacacctggatcggcatgtggcaggtatta
acggattacatcaagcccctggcgctgcggctgctgctgcaactgactatcgttatcgtg
ctcatggtttatttactttatggaactgtcgtggtgtggggggcgtag

DBGET integrated database retrieval system