KEGG   Sodalis glossinidius: SG0877Help
Entry
SG0877            CDS       T00316                                 

Definition
dihydrolipoamide succinyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
sgl  Sodalis glossinidius (Glossina spp.)
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sgl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SG0877
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SG0877
  Amino acid metabolism
   00310 Lysine degradation
    SG0877
Enzymes [BR:sgl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     SG0877
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1434824..1436014
Genome map
AA seq 396 aa AA seqDB search
MSSVDILVPDLPESVADATVATWHKKPGDSIQRDEVLVEIETDKVVLEVPAPKAGVLETL
LEDEGATVTARQVLGRLRPGDSTGQAMTEKSQSQESTPAQRHTAGLEEGSNDALSPAIRR
LIAEHDLNPEAIKGSGVGERLTREDVEKHIAGRQNAAPAPALRNRSEKRVPMTRLRKRVA
ERLLEAKNSTAMLTTFNEVNMQPVMDLRKQYGDAFEKRHGIRLGFMSFYIKAVLEALKRF
PEVNASIDGEDVVYHNYFDVSIAVSTPRGLVTPVLKDIDALGMADIEKKIKELAIKGRDG
KLKVEELTGGNFTITNGGVFGSLMSTPIINPPQSAILGMHAIKDRPMAVGEQVVILPMMY
LALSYDHRLIDGKESVSFLVTVKEMLEDPTRLLLDV
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgagtagcgtagatattctggttccagacctgcctgagtcggtagcggatgccaccgtc
gccacctggcataaaaagcccggtgacagtattcagcgtgatgaagtgctggtcgagatt
gaaaccgacaaagtggtgctggaagttcccgcccctaaagccggcgttctggaaacatta
ttggaagacgaaggcgctaccgtgaccgcccgtcaagtgctggggcgcctgcgcccgggc
gacagcaccggccaggcgatgacagagaagtcccagagccaggagtccacgccggctcag
cgccataccgcgggtctggaagagggaagcaacgacgcgctgagcccggccatccgccgc
ctcatcgccgagcacgatcttaatcccgaggctattaaaggcagcggcgtgggcgaacgt
ctgacccgcgaagacgtcgaaaaacatatcgctggccgccagaacgccgctccggcgccg
gcgctgcgcaatcgcagcgaaaaacgcgtgccgatgacccgcctgcgcaaacgcgtggcc
gaacgtctgctggaagcgaaaaacagcaccgccatgttgaccaccttcaatgaggtgaac
atgcagccggtgatggatttgcgcaagcagtacggcgacgcgtttgaaaagcgccacggt
atccgcctgggcttcatgtccttctatatcaaagcggtactggaggcgttgaaacgtttc
ccggaagtgaacgcgtctatcgatggcgaagatgtggtttaccacaactattttgacgtc
agcatcgcggtatccacgcctcgcggcctggtgacgccggtactgaaggatatcgatgcg
ctgggcatggccgatatcgagaagaaaatcaaggaactggctattaagggccgcgacggg
aaactgaaagtcgaggagctgaccggcggtaactttaccattaccaacggcggcgtcttc
ggttcgttgatgtcgacgcccatcatcaacccgccgcaaagcgcgatcctaggcatgcat
gccattaaggatcggccgatggcggtaggagagcaggtggttattctgccgatgatgtat
ctggcgctgtcttatgaccacaggcttatcgacggaaaagaatccgtcagtttcctggtg
acagtgaaagagatgctggaagatcctactcgcctgctgctggacgtttag

DBGET integrated database retrieval system