KEGG   Sodalis glossinidius (Glossina spp.): SG0878Help
Entry
SG0878            CDS       T00316                                 

Definition
(GenBank) succinyl-CoA synthase beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
sgl  Sodalis glossinidius (Glossina spp.)
Pathway
sgl00020  Citrate cycle (TCA cycle)
sgl00640  Propanoate metabolism
sgl00660  C5-Branched dibasic acid metabolism
sgl01100  Metabolic pathways
sgl01110  Biosynthesis of secondary metabolites
sgl01120  Microbial metabolism in diverse environments
sgl01130  Biosynthesis of antibiotics
sgl01200  Carbon metabolism
Module
sgl_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sgl_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sgl00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SG0878
   00640 Propanoate metabolism
    SG0878
   00660 C5-Branched dibasic acid metabolism
    SG0878
Enzymes [BR:sgl01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     SG0878
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A RelE
Motif
Other DBs
NCBI-ProteinID: BAE74153
UniProt: Q2NUM2
Position
1436130..1437296
Genome map
AA seq 388 aa AA seqDB search
MNLHEYQAKQLFARYGLPAPTGYACNTLREAEESASKIGAGPWVVKCQVHAGGRGKSGGV
KVVKLKEEIRAFAEQWLGKRLVTYQTDALGQPVNQILVEVATDIAKELYLGVVVDRGTRR
VVFMASTEGGVEIEKVAEETPHLIHKVALDPLTGPQPYQGRELAFKLGLSGKQVSQFSKI
FMGLATLFLERDLALVEINPLVITGAGDLICLDGKLSADGNALFRQPELREMRDHSQEDE
REAHATQLELNYVALDGNIGCMVNGAGLAMGTMDIVKLHGGEPANFLDVGGGATKERVTE
AFKIILSDEKVKAVLVNIFGGIVRCDLIADGIIGAVSEVGVSVPVVVRLEGNNAELGAKR
LADSGLNIIAATSLTDAAQQVVAAVEGK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaatttacatgaatatcaggcaaaacagctgtttgctcggtatggtctgcctgccccg
acgggttacgcctgcaatacgctgcgtgaagcggaagagtccgcctcgaaaatcggcgcc
ggcccctgggtggtgaaatgccaggtgcatgcgggcggccgcggtaaatccggcggcgtg
aaagtggtgaagttgaaagaagagatccgcgctttcgcggagcagtggctgggcaagcgt
ctggtgacctatcagacggacgctctgggccaaccggtcaatcagattctggtggaagtg
gccaccgatattgccaaggagctttatctgggcgtggtcgtcgatcgcggcacgcgccgc
gtggtatttatggcgtccaccgaagggggcgtggagattgaaaaggtggcggaagagacg
ccgcacctgattcataaagtggctctggacccgctcaccggcccgcagccttatcagggc
cgcgagctggcgtttaaactgggcctgagcggcaagcaggtttctcagttcagcaaaatt
tttatgggtctggcgacgctgttcttagagcgcgatctggcgctggtggaaatcaacccg
ctggtgattaccggcgccggcgatcttatctgccttgacggcaaattgagcgccgacggt
aacgcgttgttccgccagccggagctgcgcgagatgcgcgatcacagccaggaagacgaa
cgcgaagcgcacgccacccagttggagctgaactatgtggcgctggacggcaacatcggc
tgtatggtgaacggggccggcctggcgatggggacgatggatatcgtcaaactgcacggc
ggcgaaccggccaacttccttgacgtgggcggcggcgccactaaggagcgcgtgaccgaa
gcattcaagataatcctgtcggatgagaaggtgaaagcggtgctggttaatattttcggc
ggtattgttcgctgcgatttgattgccgacggcatcatcggcgcggtatccgaggttggc
gtcagtgtccccgtggtagtgcgtctggaagggaataatgccgaactgggcgccaagcga
ttggcggacagcgggctgaacattatcgccgccacaagtctgaccgacgcggctcaacag
gttgtcgccgcggtggagggtaagtaa

DBGET integrated database retrieval system