KEGG   Sodalis glossinidius (Glossina spp.): SG0878Help
Entry
SG0878            CDS       T00316                                 

Gene name
sucC
Definition
(RefSeq) succinyl-CoA synthetase subunit beta (EC:6.2.1.5)
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
sgl  Sodalis glossinidius (Glossina spp.)
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sgl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SG0878 (sucC)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SG0878 (sucC)
   00640 Propanoate metabolism
    SG0878 (sucC)
   00660 C5-Branched dibasic acid metabolism
    SG0878 (sucC)
Enzymes [BR:sgl01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     SG0878 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1436130..1437296
Genome map
AA seq 388 aa AA seqDB search
MNLHEYQAKQLFARYGLPAPTGYACNTLREAEESASKIGAGPWVVKCQVHAGGRGKSGGV
KVVKLKEEIRAFAEQWLGKRLVTYQTDALGQPVNQILVEVATDIAKELYLGVVVDRGTRR
VVFMASTEGGVEIEKVAEETPHLIHKVALDPLTGPQPYQGRELAFKLGLSGKQVSQFSKI
FMGLATLFLERDLALVEINPLVITGAGDLICLDGKLSADGNALFRQPELREMRDHSQEDE
REAHATQLELNYVALDGNIGCMVNGAGLAMGTMDIVKLHGGEPANFLDVGGGATKERVTE
AFKIILSDEKVKAVLVNIFGGIVRCDLIADGIIGAVSEVGVSVPVVVRLEGNNAELGAKR
LADSGLNIIAATSLTDAAQQVVAAVEGK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaatttacatgaatatcaggcaaaacagctgtttgctcggtatggtctgcctgccccg
acgggttacgcctgcaatacgctgcgtgaagcggaagagtccgcctcgaaaatcggcgcc
ggcccctgggtggtgaaatgccaggtgcatgcgggcggccgcggtaaatccggcggcgtg
aaagtggtgaagttgaaagaagagatccgcgctttcgcggagcagtggctgggcaagcgt
ctggtgacctatcagacggacgctctgggccaaccggtcaatcagattctggtggaagtg
gccaccgatattgccaaggagctttatctgggcgtggtcgtcgatcgcggcacgcgccgc
gtggtatttatggcgtccaccgaagggggcgtggagattgaaaaggtggcggaagagacg
ccgcacctgattcataaagtggctctggacccgctcaccggcccgcagccttatcagggc
cgcgagctggcgtttaaactgggcctgagcggcaagcaggtttctcagttcagcaaaatt
tttatgggtctggcgacgctgttcttagagcgcgatctggcgctggtggaaatcaacccg
ctggtgattaccggcgccggcgatcttatctgccttgacggcaaattgagcgccgacggt
aacgcgttgttccgccagccggagctgcgcgagatgcgcgatcacagccaggaagacgaa
cgcgaagcgcacgccacccagttggagctgaactatgtggcgctggacggcaacatcggc
tgtatggtgaacggggccggcctggcgatggggacgatggatatcgtcaaactgcacggc
ggcgaaccggccaacttccttgacgtgggcggcggcgccactaaggagcgcgtgaccgaa
gcattcaagataatcctgtcggatgagaaggtgaaagcggtgctggttaatattttcggc
ggtattgttcgctgcgatttgattgccgacggcatcatcggcgcggtatccgaggttggc
gtcagtgtccccgtggtagtgcgtctggaagggaataatgccgaactgggcgccaagcga
ttggcggacagcgggctgaacattatcgccgccacaagtctgaccgacgcggctcaacag
gttgtcgccgcggtggagggtaagtaa

DBGET integrated database retrieval system