KEGG   Sodalis glossinidius: SG0894Help
Entry
SG0894            CDS       T00316                                 

Gene name
gpmA
Definition
phosphoglyceromutase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
sgl  Sodalis glossinidius (Glossina spp.)
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sgl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SG0894 (gpmA)
   01230 Biosynthesis of amino acids
    SG0894 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SG0894 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    SG0894 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SG0894 (gpmA)
Enzymes [BR:sgl01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     SG0894 (gpmA)
Exosome [BR:sgl04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   SG0894 (gpmA)
  Exosomal proteins of melanoma cells
   SG0894 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1453210..1453962)
Genome map
AA seq 250 aa AA seqDB search
MAVTKLVLIRHGESQWNNENRFTGWTDVDLSDKGLTEAKQAGQVLKADGYVFDFAYTSVL
KRAIHTLWGVLDELDQAWLPVEKSWRLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFA
ITPPELTREDERFPGHDPRYANLSAAELPTTESLALTIDRVIPYWNETILPRMKSGERII
IAAHGNSIRAMVKFLDNLSEEEILELNIPTGVPLVYEFDDNMKPIKHYYLGNADEIAAKA
AAVANQGKAK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggctgtaactaaactggttctgatacgtcacggcgaaagccagtggaacaatgaaaac
cgtttcaccggctggacggatgtagacctgtctgacaagggcctcaccgaagcaaagcaa
gcgggccaggtactgaaagcggatggctatgtctttgatttcgcctacacctcggtactg
aagcgcgctattcataccctctggggcgtcctggacgagctggaccaggcctggctgccg
gtggaaaaatcctggcgtttgaatgagcgtcattacggtgcactgcaagggctcaataaa
gccgagaccgcggaaaaatacggtgacgagcaggtgaaacagtggcgtcgcggtttcgcg
attacgccgccggaactcacccgtgaagatgagcgtttcccgggccatgacccccgctac
gccaacctgagcgccgccgagctgccgactaccgaaagcctggcgttgaccattgatcgc
gtgattccttactggaacgaaacaattcttccccgcatgaagagcggtgagcggatcatt
atagctgcccacggtaactccattcgcgccatggtgaaattcctggacaatctgagcgaa
gaagaaattctggaactgaatattccgacgggcgtgccgttagtgtacgaattcgacgac
aatatgaagccgattaaacattactacctcggcaacgctgacgagatcgccgccaaagcc
gccgcggtcgccaatcagggtaaagcgaaataa

DBGET integrated database retrieval system