KEGG   Sodalis glossinidius: SG0911Help
Entry
SG0911            CDS       T00316                                 

Definition
D-cysteine desulfhydrase (EC:4.4.1.15)
Orthology
K05396  
D-cysteine desulfhydrase [EC:4.4.1.15]
Organism
sgl  Sodalis glossinidius
Pathway
Cysteine and methionine metabolism
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:sgl00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1478628..1479620
Genome map
AA seq 330 aa AA seqDB search
MSDLAQRLAGVPRLDIIGPPTPLEHLPRLSDFLARDIFIKRDDLTPLGLGGNKLRKLEYL
AADALRQGADTLLTAGAIQSNHVRQTAALAAKLGLHCVALLEKPIDTPAGNYLTNGNRLL
LDLFQCEVIACEALTQPAQQLADASLRLEAQGFRPYVIPVGGSNALGSLGYVGCALEIAH
QCQGVIQPGAVVVSSGSGGTHAGLEVGLAAVLPETAFIGVTVSRRSEQQRPLIASLAAQV
SEQLSLAAPAAEITLWDEYFAPGYGQLNDEGREAIALLARLEGIVLDPVYAGKAMAGLID
GLERDRFPDGPLVCSCIPAALFAYHYLETR
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgagcgatcttgcccaacggttggccggcgttccccggctggatattatcggcccgccg
acgccgctcgaacatctcccccggctgtcggactttctggcgcgggatatctttatcaag
cgcgacgatttaaccccgctgggcctgggcggtaacaagttgcgcaagctggagtacctg
gccgctgacgcgctgcgccagggtgccgacacgttgctgaccgccggtgctatccagtcg
aaccacgtgcggcaaacggcggcgctggcggccaaattggggctgcattgcgtcgcgctg
ttggaaaagccgatcgacacacccgccggtaactacctgaccaacggcaaccgtctgttg
ctcgatttgtttcagtgcgaggtcatcgcgtgcgaggccctgactcagcctgctcaacag
ctggccgatgcgtcgctgcgtctggaggcacagggctttcggccctatgtcataccagtg
gggggatccaacgccctgggctcgctgggttacgtcggttgtgcgctggagatagcccat
cagtgtcaaggtgtgatccagccgggcgcggtagtggtgtcatcgggcagcggcggcacg
cacgcgggactggaggtcggtctggccgccgtgctgccggaaacggcgtttatcggcgtt
accgtttcgcgtcgctcggaacagcagcggcctcttatcgccagtctggcagcgcaagtg
agtgaacagttgtctctcgccgcgccggccgcggagataaccctgtgggatgagtatttt
gcccccggttatggccagctcaatgacgagggccgcgaggcgattgcgctattagcgcgt
ctggagggcattgtgctggatccggtttatgccggtaaggccatggcagggctgattgat
ggccttgaacgcgaccgttttcctgacgggccactggtgtgttcgtgcataccggcggcg
ctgtttgcttatcattatctggagacccgatga

DBGET integrated database retrieval system