KEGG   Sodalis glossinidius (Glossina spp.): SG1161Help
Entry
SG1161            CDS       T00316                                 

Definition
hypothetical protein
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
sgl  Sodalis glossinidius (Glossina spp.)
Brite
Enzymes [BR:sgl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     SG1161
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1949040..1949477
Genome map
AA seq 145 aa AA seqDB search
MNISQNGLERIKAFEGLQLTAYQCSADRWTIGYGHTNGVKAEDVIPLEQADAFLRDDIDA
VVERLNALITVPVAQNQFDALCSLVFNIGIGAFAKSTLLKKLNESDYPGAAVEFSKWCHA
TVDGKKVSLPGLIKRRQEEKALFEP
NT seq 438 nt NT seq  +upstreamnt  +downstreamnt
atgaatatcagtcagaatggattagaacggataaaggcgtttgaggggcttcagctcacc
gcatatcaatgcagcgcagacagatggactatcggctacgggcatacgaacggcgtcaag
gcagaggatgttatccccctcgaacaggcagacgcttttctgcgtgacgatatcgacgcc
gtggttgaacgactgaatgccttgataaccgtgccggtggcacagaatcagttcgacgca
ttgtgttcactggttttcaatatcggcatcggggcatttgctaaatcgacgttgcttaaa
aagctgaatgaaagtgattaccccggggcagcggtagagttctccaaatggtgccatgcg
accgttgacggtaaaaaagtgtcgttgccaggcttgattaagcgcaggcaggaagagaaa
gctttatttgaaccatga

DBGET integrated database retrieval system